KEGG   Klebsiella variicola At-22: Kvar_1353Help
Entry
Kvar_1353         CDS       T01170                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00130  Ubiquinone and other terpenoid-quinone biosynthesis
kva00627  Aminobenzoate degradation
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01220  Degradation of aromatic compounds
Module
kva_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Kvar_1353
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Kvar_1353
Enzymes [BR:kva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Kvar_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADC57279
Position
1430497..1431081
Genome map
AA seq 194 aa AA seqDB search
MKRLIIGISGASGAIYGVRMLQVLRDVPEIETHLILSQAARQTLALETDFSVRDVQALAD
VVHDARDIAASISSGSFKTAGMVILPCSMKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPFHLGHLRLLVQAAELGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFDISLSQ
DLFTRWQGAQDCTK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgactgattattggcatttctggcgccagcggcgctatctatggcgtgcggatg
ctgcaggtgttgcgggatgtgccggagattgagacccatctgatcctcagccaggcggca
cggcaaacgctggccctcgagaccgacttcagcgtgcgcgacgtgcaggcgctggccgat
gtggtgcatgacgcccgcgatatcgccgccagtatctcttccggttcgtttaaaaccgcc
ggtatggtgattttaccctgctcaatgaaaacgctctctggcattgtccatagctatacg
gatggcctattgacgcgggcggccgatgtcgtgctgaaggagcgtcgtccgctggtgctc
tgtgtgcgggagaccccgttccatctcggccatctgcgactgctggttcaggccgcggag
ctcggggcggtgataatgccgccggtgccggccttttatcatcggccgcaaagcctggat
gatgtcatcaaccaaaccgtcaaccgggtgctcgatcagttcgatattagcctgtctcaa
gacttgtttactcgctggcagggggcacaggattgcactaaataa

DBGET integrated database retrieval system