KEGG   Klebsiella variicola At-22: Kvar_1579Help
Entry
Kvar_1579         CDS       T01170                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00340  Histidine metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01230  Biosynthesis of amino acids
Module
kva_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Kvar_1579
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Kvar_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADC57504
Position
complement(1703957..1705261)
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNGCSADQQQQLLTRPAISASDSISKTVAEILDNVKANGDAALREYSAKFDK
TTVAALQVSEAEIAAAGERLSDELKQAMAVAVKNIETFHNAQQLQAVDVETLPGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQQVVLCSPPPIADEILYAAQLCGVKT
IFNVGGAQAIAALALGTESVPKVDKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADLGSRVAEAVERQLAALPRAETARV
ALSASRIIVARDLAQCVAISNQYGPEHLIIQTRQARELVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFAALASTIEILAAAERLDAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacacaatcatcgactggaacggctgtagcgcagaccaacagcaacaactc
ttaacgcgcccggcgatttccgcctccgacagcatcagtaaaacggtggcggagatcctc
gataacgtcaaagccaacggcgacgcggcgctgcgcgaatacagcgcaaagtttgataaa
accaccgtcgccgcgctgcaggtgagcgaggcggagatcgccgccgccggcgaacgcctc
agcgacgagctgaagcaggcgatggcggtggcggtgaaaaacatcgagaccttccacaac
gcgcaacagctgcaggcggtggatgtcgaaacgctgccgggggtgcgctgccagcaggtc
acccgccctatcgcctccgtcgggctgtatattccgggcggctcggcgccgctgttctcc
acggtgctgatgctggcgacgccggcgcgcatcgccggctgtcagcaggtggtgctctgc
tcgccgccgccgatcgccgatgagatcctctatgccgcgcagctgtgcggcgtgaaaacc
atctttaacgttggcggcgcccaggccatcgccgccctcgccctcgggaccgaatcggtg
ccgaaggtggataaaatctttggcccgggtaacgcttacgtcacggaagccaaacgtcag
gtcagccagcgtctggacggcgcagccatcgacatgccggccggcccgtcggaagtgctg
gtgatcgccgacagcggcgccaccccggactttgtcgcctccgacctgctgtcgcaggcg
gaacacggcccggactcgcaggtgatcctcctgaccccggacgccgacctcggcagccgc
gtcgctgaggccgtcgaacgccagctggccgccctgccgcgcgcggaaaccgcccgcgtg
gccctctccgccagccggatcatcgtggcccgcgacctggcgcagtgcgtggctatctcc
aaccagtatggcccggagcacctgatcattcagacccgtcaggcccgcgagctggtggac
agcatcaccagcgccggttcggttttcctcggcgactggtcaccggaatccgcgggcgat
tacgcctcgggcaccaaccacgtcctgccgacctatgggtataccgccacctgttcgagc
ctcggcctggccgacttccagaagcggatgaccgtgcaggagctgtcgcgcgatggcttt
gccgccctcgcctcaacgattgagatcctggccgccgccgagcgccttgacgcccacaaa
aacgccgtaacgctgcgcgttgccgccctgaaggagcaagcatga

DBGET integrated database retrieval system