KEGG   Klebsiella variicola At-22: Kvar_2870Help
Entry
Kvar_2870         CDS       T01170                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00071  Fatty acid degradation
kva00072  Synthesis and degradation of ketone bodies
kva00280  Valine, leucine and isoleucine degradation
kva00310  Lysine degradation
kva00362  Benzoate degradation
kva00380  Tryptophan metabolism
kva00620  Pyruvate metabolism
kva00630  Glyoxylate and dicarboxylate metabolism
kva00640  Propanoate metabolism
kva00650  Butanoate metabolism
kva00900  Terpenoid backbone biosynthesis
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
kva01212  Fatty acid metabolism
kva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kvar_2870
   00630 Glyoxylate and dicarboxylate metabolism
    Kvar_2870
   00640 Propanoate metabolism
    Kvar_2870
   00650 Butanoate metabolism
    Kvar_2870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Kvar_2870
   00072 Synthesis and degradation of ketone bodies
    Kvar_2870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kvar_2870
   00310 Lysine degradation
    Kvar_2870
   00380 Tryptophan metabolism
    Kvar_2870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Kvar_2870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kvar_2870
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Kvar_2870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kva04147]
    Kvar_2870
Enzymes [BR:kva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Kvar_2870
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kvar_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADC58756
Position
complement(2985243..2986448)
Genome map
AA seq 401 aa AA seqDB search
MNKVYIVAACRTPVGRFLGALKTVSAVELAALTVRHNLQQAGIDPAWIDEVICGCVLAAG
QGMGPARQVALRAGIPVQKPAYTLNMICGSGMKSITEGAIHIQSGYADLVVAGGMENMSQ
APFLLRGEIRGGVKFGAFSSEDLIQSDGLTDPLLHIPMGETAEAIAAHEQISRAEQDQYA
LDSHQKASAASRAGHFAEEIVPVTVSGKRGVSVVREDEQIRHDLSADQLAALKPAFRRDG
SVTAGNASGLNDGAASVILASARAVAQYGLRPLAEIVAFGEGGVDPAMMGLGPLPAMTCA
LRRGRFQLSDMARLEINEAFAAQVLGVVKGLAREHQMTAEEIAARLNVNGGAIALGHPLG
SSGTRIVVSLLHALRRENKPTGLASLCIGGGMGIALIVKTI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgtatatcgtcgcggcctgccgtacgccggtggggcgttttcttggcgcc
ctgaaaacggtctctgcggtggaactggccgcgctcaccgtccgccacaacctgcagcag
gccgggattgacccggcgtggattgacgaagtgatctgcggctgcgtcctcgccgccggg
caggggatggggccggcgcgtcaggtcgcgctgcgggcggggatcccggtgcaaaagccg
gcttacaccctgaatatgatctgcggtagcggcatgaaaagtattaccgagggggcgatc
catatccagagcggttatgccgacctggtcgtcgctggcgggatggaaaacatgagccag
gcgccgtttttgctgcggggagagataaggggcggcgtgaaatttggcgcgttcagcagc
gaggatctgatccagagcgatggcttaaccgatccgctgttgcatattccgatgggggaa
acggcggaggccatcgccgcgcatgagcagatctcgcgcgcagaacaggaccagtacgcg
ctggacagccatcaaaaagcctccgccgccagccgcgccggccattttgccgaggagata
gtgccggtgacggtcagcgggaagcggggcgtcagcgtggtccgcgaggatgagcagatc
cgccatgaccttagcgccgaccagctggcggcgctgaaaccggcttttcgtcgcgacggg
agcgtcacggcgggcaacgcctcggggctgaacgacggcgcggcgtcagtgatcctcgcc
tcggcgcgcgccgttgcgcagtacggcctgcggccgctggctgagatagtcgccttcggc
gagggcggcgtcgacccggcgatgatggggcttgggccgctgccggccatgacgtgcgct
ctgcgccgcgggcgttttcagctcagcgatatggcgcgactggaaattaacgaagccttt
gccgcgcaggtgctgggggtggtcaaggggctggcccgcgagcatcagatgacggcggag
gagatagccgcccgcctgaacgtcaacggcggcgcgattgccctcgggcacccgctcggc
agttccggaacccggattgtcgtgagcctcctgcacgcgctgcgccgggagaataaaccg
accggcctggcctcgctgtgtatcggcggtgggatgggtattgcgttaattgtgaaaacg
atctga

DBGET integrated database retrieval system