KEGG   Klebsiella variicola At-22: Kvar_2893Help
Entry
Kvar_2893         CDS       T01170                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00071  Fatty acid degradation
kva00280  Valine, leucine and isoleucine degradation
kva00281  Geraniol degradation
kva00310  Lysine degradation
kva00360  Phenylalanine metabolism
kva00362  Benzoate degradation
kva00380  Tryptophan metabolism
kva00410  beta-Alanine metabolism
kva00627  Aminobenzoate degradation
kva00640  Propanoate metabolism
kva00650  Butanoate metabolism
kva00903  Limonene and pinene degradation
kva00930  Caprolactam degradation
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01212  Fatty acid metabolism
Module
kva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Kvar_2893
   00650 Butanoate metabolism
    Kvar_2893
  Lipid metabolism
   00071 Fatty acid degradation
    Kvar_2893
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kvar_2893
   00310 Lysine degradation
    Kvar_2893
   00360 Phenylalanine metabolism
    Kvar_2893
   00380 Tryptophan metabolism
    Kvar_2893
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kvar_2893
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Kvar_2893
   00281 Geraniol degradation
    Kvar_2893
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kvar_2893
   00627 Aminobenzoate degradation
    Kvar_2893
   00930 Caprolactam degradation
    Kvar_2893
Enzymes [BR:kva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Kvar_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADC58779
Position
complement(3011329..3012096)
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGRVLQLTLNRPQARNALNNALLTQIAEALEVAAVDDSVGVCVISGNPRFFA
AGADLNEMAEKDLPATLDDIRPRLWARIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDAHQAQQAGLVSDIYPA
ALTDEYALKLAATIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggccgggtgcttcagttgacgctaaaccgcccg
caggcccgcaacgcgctgaacaatgccctcttaacccagattgccgaggcgctggaggtt
gcggcagttgatgacagcgtcggcgtctgcgttatcagcggcaacccgcgtttttttgcc
gccggggctgacctcaatgagatggcggagaaagatctgcctgccaccctggatgatatt
cgcccacggttgtgggcgcgaattgatgctttcactaaaccgctcatcgcttcggtcaac
ggctacgcgcttggcgccggctgcgagctggccctgctgtgtgacctgattgtcgccggc
gacaacgcccgttttggcctgccggaaattaccctcggcattatgccgggcgctggcggc
acccagcggctgatccgcagcgtaggtaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccaccaggcgcagcaggccgggctggttagcgatatttatccggcg
gcattaaccgatgagtatgccctgaaactggcagccaccatcgcccgccattcgccgctg
gcgctccgggcggcaaaacagtcgctgcgtctgtcgcaggaagtcagcctgcaggccggt
ctgcaacaggagcgccagctgtttagcttgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtacaccggaatttaaaggacgctaa

DBGET integrated database retrieval system