KEGG   Klebsiella variicola At-22: Kvar_2954
Entry
Kvar_2954         CDS       T01170                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
kva  Klebsiella variicola At-22
Pathway
kva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Kvar_2954
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2954
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2954
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ADC58840
Position
complement(3074324..3074866)
AA seq 180 aa
MLRTSLTKTACLLPLLALCLSGCGLTQRVSEGTKNAFNAVFYKKINTLHLDFTAREALNT
DARENHSLSEPVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDAS
LNMPLEAEATFVAVVGLFRYPDTERNTWKQVLGREELDPDKPRIFTAERNQLRLRPEAAK
NT seq 543 nt   +upstreamnt  +downstreamnt
gtgttacgtacaagtttgactaaaaccgcctgcctgctgcccctgcttgcgctttgtctg
agcgggtgcgggctcacccagcgcgtctcggaggggaccaaaaatgccttcaacgccgtt
ttttataagaaaattaatacgctgcatctggactttaccgcgcgtgaagcgctcaacacc
gatgccagagagaatcactcgctctctgaaccggtggtggtgcgcatctatcagcttaaa
gatcgccagacctttgaccggctggtttaccagcagctgctggaggagggggatattctg
ctcgccgccgatctcctcgccagtcgcgatgtggtgatcggtcccggaggggatgccagt
ctgaatatgccgctggaagcggaggcgacgttcgtggcggttgtcggcctgttccgctat
ccggacacagaaagaaatacctggaagcaggtgctggggcgtgaggaattggatccggac
aagccgcgcattttcaccgccgaacgcaaccagctacggctcaggcctgaagcggcgaag
taa

DBGET integrated database retrieval system