KEGG   Klebsiella variicola At-22: Kvar_2955
Entry
Kvar_2955         CDS       T01170                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
kva  Klebsiella variicola At-22
Brite
KEGG Orthology (KO) [BR:kva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2955
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2955
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADC58841
Position
complement(3074844..3075929)
AA seq 361 aa
MGREAQPTHSRLNPRLEADLPRINFYRFCQLLEKRRPGQPLMGATSHPADDPVRFYPHPG
MGFPASELRAVEYDEADDCGPPVIRTTFMGLYGVDSPLPTAYLDDIAQRREGHEALQGLL
DIFSHRIMTQFYRIWRKYSWPATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLA
LTGVLRQPGKTQQGIQALVTLLAPETTVRVSPYSLRPVAISQPLGFYGDDDFLLDGNMPL
GDEAMDASSQLLVALTTDNPAEAQGSKPDGPLFRDFLILLRVYLGWRFRADITLTAPTRL
LAVPPLGDEPFWLGMNGMLGVGEGESQDDIPQTFTTELGTYTGLQPATFLQGNRRVTYKF
D
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgggaagagaagcacagccgacgcattcccggctgaacccgcggctggaggccgacctg
ccgcggatcaatttttaccgcttctgccagcttctggaaaaacggcgtcctggccaaccg
ctgatgggggcgaccagccatccggctgacgatccggtgcgtttttacccgcatccgggg
atgggattcccggccagcgaactcagagccgtggaatacgatgaggccgatgactgcggg
ccgccggtcattcgcaccacctttatggggttgtacggtgtcgattcgccgctcccgacg
gcatatctcgatgatatcgcccagcgcagggaagggcatgaagcgctgcagggcttactg
gatatcttcagccaccggatcatgacgcagttttaccgcatctggcggaaatactcctgg
cccgccacctttgagcctggcggcaccgatcgtctctcgcagtcgctgctgggcctggcg
gggttgggcatccccggcacgacgcagcatatcgcttcgccggcgtcgcgctttctggcg
ctaactggcgtgctgcggcagcctggcaaaacccagcaggggatccaggcgctggtcacc
ctgctggccccggagaccaccgtcagggtgagcccgtacagcctgcgtccggtggcgatc
agtcagccgctggggttttacggcgatgacgacttcttactggacggcaatatgccgctg
ggtgacgaagcgatggatgccagcagccagctcctcgtcgcccttaccaccgacaatccc
gcggaggcgcagggctcgaagcctgacggcccgctgtttcgggactttctcatcctgctg
cgggtatacctcggctggcgattccgggccgacatcaccctgaccgcgccgacccgactg
ctggctgtcccgccgctgggggacgagccgttctggctcggtatgaacggcatgctgggt
gtgggggagggcgagagtcaggacgatattcctcagacctttaccaccgagctgggtacc
tatacgggcctgcagcctgccacctttctacaaggaaaccgacgtgttacgtacaagttt
gactaa

DBGET integrated database retrieval system