KEGG   Klebsiella variicola At-22: Kvar_2957
Entry
Kvar_2957         CDS       T01170                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
kva  Klebsiella variicola At-22
Brite
KEGG Orthology (KO) [BR:kva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2957
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2957
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N HEPPP_synt_1
Other DBs
NCBI-ProteinID: ADC58843
Position
complement(3077727..3079319)
AA seq 530 aa
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLSPISDSQPTGSDPGYDDDFQRIREEVN
KISGVDTELICQLAEKLLTQTCKDLRVITFYVWARLQREGESGLAEGVTLLAAMLERFGA
MLHPQRERSCKSALEWLGSRRMSDSLSLYPEVDMTTMQVIIGALLLAEASFAGLAEASRP
DLSGLYQILENRLVQNGGARSLVPQTSREEHDLLPQHADTAPVMHTVTSGRDLLDQAKVL
AKYLRECPGGWLAGHHLMKSVRWDTLTELPPLDASGRTRLLPPKPESKAHLKRLYLQKSW
SELLEHTDTLLAQGVNHLWLDVQWYAWQALLKLDADSVRADILCRDMKGLLARLPGLETL
AFNDGTPFADEVTLNWLNERVLDEMAGWQDEPVMAATSADEVLSLEPEVLTRADDEGIES
ALNWLQAQPGYTTSRNRWLMRLLMARVSEQYGKNEMALHLLAELDSRAREMTLEQWKPEL
IFEVKARRLRLLRGKAGRSEAEKNRLLPEMESLLAGLIALDPARAAVLCA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagcattttacaaaatttggttgccgccagtcagttggatgaaagcgtactgcgccag
caggcccggtcacgtcaggcgcagtggcagtcctggctttcgccaatcagtgatagccag
cccaccgggagcgatccgggctatgacgatgattttcagcgtatccgcgaggaggtcaat
aagatctccggtgtcgataccgagctgatttgccagctggcagaaaaactgctgactcag
acctgcaaggatctgcgcgtgatcaccttttacgtgtgggcgcgtctgcagcgggaaggc
gagagcggtctggcggaaggcgttacgctgctggcggcaatgcttgagcggtttggggct
atgctccatccccagcgtgaacgtagctgtaaatcggcgctggaatggcttggcagtcgc
cggatgtcggacagtctgtctctttatccggaagtcgacatgaccactatgcaggtcatt
atcggggcgttattgctggcggaagcctcttttgccggcttggctgaggcatcccgcccc
gatctttccgggctataccagatactggagaaccgcctggtgcaaaacggcggagcccgc
agtctggtgccgcagaccagccgcgaagaacacgatctgctaccccaacatgcggacacc
gcgccggtaatgcataccgtcacgtcaggtcgtgatttgctcgatcaggctaaggtgctg
gcgaaatatctgcgcgagtgtcccggcggatggctggcaggtcatcatctgatgaagagt
gtgcgttgggataccttaacggagttaccgccgctggatgcctccggccggacacggcta
ttgcctcccaagcctgagagtaaagcccatcttaagcggttgtatttacagaaaagctgg
tcggaactgctggagcatacggacacgctgttggcgcaaggcgtcaaccatctgtggctg
gatgtgcagtggtacgcctggcaggcgctgctgaaactggatgctgacagtgtacgtgcc
gatatcctgtgccgggatatgaaagggctactggctcgtctgccggggctggaaaccctg
gcgtttaacgatggtacgccattcgccgatgaagtaacgctcaactggcttaacgagcgt
gttctggatgagatggccggatggcaagatgaaccggtaatggcggcgaccagcgctgat
gaggtgctgtcgctggagccagaagtgctcacccgcgcggacgatgaaggtattgagtcg
gcgctgaactggttacaggcgcagccgggctataccaccagccgcaatcggtggctgatg
cgcttattgatggcgcgggtcagcgagcagtacggaaaaaatgaaatggcgctgcatctg
ctggcggaactcgacagccgcgcccgggaaatgacgctcgaacaatggaagccggagctt
atctttgaggtcaaagcccgccgactccggctgctcagaggcaaggccgggcgcagtgag
gcagaaaaaaatcgcttgctgccagaaatggagtcattgcttgccgggcttatcgctctg
gatcccgctcgcgctgcggtgctgtgcgcataa

DBGET integrated database retrieval system