KEGG   Klebsiella variicola At-22: Kvar_2958
Entry
Kvar_2958         CDS       T01170                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
kva  Klebsiella variicola At-22
Pathway
kva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Kvar_2958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2958
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2958
SSDB
Motif
Pfam: IcmF-related IcmF_C OPT
Other DBs
NCBI-ProteinID: ADC58844
Position
complement(3079319..3082744)
AA seq 1141 aa
MDNVNKPAAISVAATVIVCIAAVTLLVLLGGLAWWLWAMDRATQWETLRPLIATGFIIWG
MALSLLVLGFMAFRLLIKDKVKPSAAPVRQPTRPAGREALYAPLKKHLHARYRLRWRRKV
RLLLVTGDDAAIEQLAPGLRQQQWLEGNRTVLIYGGNLITEPDQEKYAALRKLRRGRPLD
GIVRVMPSSLTLTPQISESDLHGLEKISELLGYAAPVWLWKLCDSEWSQADRAVQAVGVS
FPLRATEDDVARQLAQMLPTLREQGMRQIAADTRHDFLLRLGQRLIDGGIAQWRWQLAPW
LTASRQRLALRGLMFSLPEPRTVDPYQEADALPANQPHLLTLPATWQGIVDDCRRLRGHH
VGMAWERGLACGLLAILGLWAAGLLLSFALNYSQIATVAGKARDLVAHPSVSDYQLTALH
ALRNEAGRLVHDGQKGAPWYRCFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALS
TLVNSAPNSDQRAQLAKPGYDQLKAWLMMARPDKADGAFFAQTMKAVQPTRMGISTGLWQ
SLAPDLWAFYLSLLPERPEWKIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRN
FADVSLEDMTSGTDARRLFTTDEVVPGMFTRQAWEGGIQQAIDKAASSRREEIDWVLSDS
RKTMSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNPTTNIADVTDQLTLISDVRQS
PLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSATGPQGPLDDTFGPL
LQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLRLQQVANASDPQEMMQTLAQTVFQGKS
VDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANW
HTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVPDKVNSH
GLVFNPAFLRAIDQLSQLSDILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQM
ADWQTFRWPGETYKPGTLLTWTTVNAGTRLFGDYSGTWGFIRWLEQGKRHPLDRSQWMMS
FSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVDAAESAQALTTGVGNSDMDEM
E
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggacaacgtcaataaacctgccgctatctctgtggcggctacggttatcgtctgtatt
gctgcggtcacgcttctggtgctcctgggcgggctggcatggtggctgtgggcgatggat
cgtgccacgcagtgggaaacgctgcgcccgcttatcgccacgggctttattatctggggg
atggcactcagcctgctggtactggggtttatggcctttcgactgctgataaaagataag
gttaagccttcagcagcgcctgtgcggcaacccaccaggcccgccgggcgcgaagccctt
tatgccccgctgaaaaagcaccttcacgcacgttaccgcctgcgctggcgccgcaaagtc
cgcctgctgctggttaccggggacgatgcagcaatcgaacaactggcgcctggtctgcgt
cagcagcagtggcttgaaggtaaccgcactgtgctgatttacggcggtaacctgatcaca
gagcccgaccaagaaaaatacgccgcgctgcgcaagctgcgccgcggccgtcctctggac
gggattgtgcgggtgatgccgtcgtctctcaccctgacgccgcagataagcgagagcgac
ctgcacgggctggaaaaaatcagcgaactgctgggctatgccgccccggtctggctgtgg
aaactgtgcgacagtgagtggtcgcaggctgaccgcgcggtacaggcggtaggcgttagc
ttcccgttgcgcgccactgaggacgatgtcgcccgtcagcttgcgcagatgttgcccacg
ctgcgggagcaggggatgcgccagatcgcagcagatacccgccacgactttctgctgcgt
ctggggcagcggcttatcgacggggggatcgcgcaatggcgctggcagctggcgccgtgg
ctgaccgcctcgcggcagcggcttgcgctgcgtggcctgatgtttagcctgccagagcct
cgtaccgtagatccgtatcaggaagctgatgccctgcctgcgaaccagcctcatctcctg
acgctgcccgcgacctggcaggggatcgtcgatgactgccgccgtttacgcgggcatcac
gtgggaatggcatgggagcggggcctggcgtgcggtctgctggccatcctcggcctgtgg
gcagcgggactgctgctctcctttgcccttaattacagccagattgctacagtcgcggga
aaagcccgcgacctggtggcccacccctctgtttctgactatcaactgacggccctccat
gccctgcgcaatgaggccggccgtctcgtgcacgatgggcagaagggcgctccctggtat
cggtgctttggtctggaccatcatcagcagctattaaacgccgtcctgccctggtacggt
gtggcaaatcatcgcctgatacgtgacccggccaatgccgcgttgcagcaggcgctcagc
acgctggtcaactccgcccccaatagcgaccaacgagcccagctggcgaaaccgggctat
gaccagctgaaagcctggctgatgatggctcgtccggataaagccgatggcgcatttttc
gcgcagaccatgaaagcggtccagccgacgcgaatggggatctcgaccggtctgtggcaa
agtctggcgccggatttgtgggccttttatctctccctgctgcccgagcggccagagtgg
aagatcatcccggatgcgcaacgggtgagtcagagccgtcaggttctgttgcagcagcta
ggtcgccgcaatgccgaaagcaccttatatgagaacatgctcaaatccgtgcgtcgtaat
tttgccgatgtgtcgctggaagacatgaccagtggcaccgacgcgcgccgcctgtttacc
accgatgaagtggtcccggggatgtttacccgccaggcatgggaaggcggcattcagcag
gccattgataaggcagccagctcgcgccgggaggaaatcgactgggtgctgagcgattcg
cgcaaaacgatgtcgacagatctgtcgccggaggcgctgaaagcgcgtctgacccgacgc
tacttcaccgatttcgccggcagctggctgaattttctcaacagtctgcgactcaacccg
acgaccaatatcgccgatgttaccgaccagctcacgctgataagcgatgtccgtcagtca
ccgctgattgccctgatgaatacccttgcctggcaggggcaggcggggcaacaaagggag
gggctgtcggacagccttattaaatcggccaaagacctggtgggcgggaaagacaagccg
gtcatcgaccagtcggcaaccggcccgcaggggcctctggatgacacgttcggcccactg
ctccagctgatggggaaaaacacgggcagcaacgtcatgtcggccgatagcaccctgagc
ctgcaaacctatctgacccgtatcacccgcgtgcgcctgcgcctgcagcaggttgcgaat
gcctccgatccgcaggagatgatgcagaccctggcgcagaccgtcttccaggggaaaagc
gtcgacctgaccgacacgcaacagtacggtagcctgatttcggcgagtcttggcgaagag
tggagtggcttcggtaatactctgtttgtgcagccgctaactcaggcctgggaaaccgtg
cttctgccgtcggcggccagtctgaatgacaaatggcgccgatcggtggtcgccaactgg
cacaccgcctttgacggacgctttccgtttgccgccagcaaaagcgacgcctccctgccg
atgctggctgagtttgtgcgcaaagacagcgggcgaatcgaacgttttctcacgacggag
ctgaacggtgtcctgcataaagaaggtagtcagtgggtgccggataaggtcaacagtcac
ggcctggtctttaatccggcctttctgcgcgcgatcgaccagctaagccagctgtccgac
attcttttcaccgacggcagccaggggatcagctttgagttacaggccaggcctgccccg
gaggttgtcgagacacagctgacgatagacggccaaaagctgcgctatttcaatcagatg
gccgactggcagactttccgctggccgggggagacgtataaacccggcactctgctgacc
tggaccaccgtcaatgcgggcacgcgtctgttcggtgactacagcggtacctggggcttt
attcgctggctggagcagggtaaacgccatccgctggatcgcagccagtggatgatgagc
ttctccgctccggatggccgcaccctgcagtgggtattgcgctcccagcttgggagtggc
ccgctggcgcttctggcgctgcgcggattgaccctgccggatcagattttcactgtcgat
gcggctgagagcgcacaggccctgacgacgggggtagggaatagtgacatggatgagatg
gaataa

DBGET integrated database retrieval system