KEGG   Klebsiella variicola At-22: Kvar_2970
Entry
Kvar_2970         CDS       T01170                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kva  Klebsiella variicola At-22
Pathway
kva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Kvar_2970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2970
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2970
SSDB
Motif
Pfam: T6SS_HCP Inhibitor_I24
Other DBs
NCBI-ProteinID: ADC58856
Position
complement(3095601..3096092)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaagggtct
gtcgacgttcaggatcgtgaaggcagtatcgaagtggtggcccaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacgcgtattcatacgccgttcctg
ttcaccaaggagatcgactcctccagcccctacctgtacaaggcagtgaccaccggccag
accctgaaatccgctgagttcaagtggtaccgaatcaacgatgccggccaggaagtggag
tatttcaataccaaacttgagaacgtcaaggtggtgaaagtgaatcccctgatgcacgac
atcaaaaaccccgcctacgagaagcacaaccatctggaacagattgagctgcgctacgag
aagatcacctggacctataaagacggcaacatcattcactccgatagctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system