KEGG   Klebsiella variicola At-22: Kvar_2975
Entry
Kvar_2975         CDS       T01170                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
kva  Klebsiella variicola At-22
Brite
KEGG Orthology (KO) [BR:kva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kva02044]
    Kvar_2975
Secretion system [BR:kva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kvar_2975
SSDB
Motif
Pfam: T6SS_VipA GerD
Other DBs
NCBI-ProteinID: ADC58861
Position
complement(3101426..3101917)
AA seq 163 aa
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNK
NNFNSVLSEFSPEVNLSVPNTLSGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMR
NLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctgatacgttccagaatgaagtccccagggcgcgcattaatctcaaattatctctt
cataccggcggcgcgcagaagaaggtcgagctaccgctgaagctgcttaccattggcgat
tttagtcatggtaaggaaaaccggcctttatcggaaagagaaaaaatcaacgtcaataaa
aataactttaacagcgtactttcggaatttagcccggaagttaacctctcggtgccgaat
acgctgtccggcaatggtgaagaggagaacgtcagactgcgttttaccgatatcaaagat
tttgaaccggagcaggttgcccggcaaattccgcaactccgcgccatgctggcgatgcgt
aatttattacgcgatctcaaatccaatctgcttgataacgccactttcagaaaagagctt
gaggcaatcctgaaagatccggcgctgtcccaggaattacgcgacgaaatgagtgcgctt
gccccgaaataa

DBGET integrated database retrieval system