KEGG   Klebsiella variicola At-22: Kvar_3107Help
Entry
Kvar_3107         CDS       T01170                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00450  Selenocompound metabolism
kva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Kvar_3107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kva03016]
    Kvar_3107
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Kvar_3107
Transfer RNA biogenesis [BR:kva03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Kvar_3107
 Prokaryotic type
    Kvar_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ADC58992
Position
complement(3239261..3240304)
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETSDDAAVYDLGNG
TSIVSTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIARE
VVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERIKKNSTAQAGCKLYLTKPL
GIGVLTTAEKKSLLKPEHQGLATETMCQMNLAGAAFAAIDGVKAMTDVTGFGLLGHLSEV
CRGAGVQAQLRYADIPKLPGVEGYIAAGAVPGGTGRNFASYGHLMGEMPAEWRDLLCDPQ
TSGGLLLAVTPEAEAEVQAAAAEFGIKLAAIGELVTARGGRPMIEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagccattcgtttaacgcaatacagccacggagccggttgtggttgtaaa
atttccccgaaggtgctggaaaccatcctgcatagcgagcaggcgaagtttgtcgatccg
aacctgcttgtcggcaacgaaaccagcgacgatgccgccgtctacgatcttggtaacggc
acgtcaatcgttagcaccaccgatttctttatgccgatcgtcgataatccgttcgacttt
ggccgcatcgccgccaccaacgccatcagcgatattttcgccatgggcgggaaaccgatt
atggcgattgccatccttggctggccgatcaacaccctggcgccggaaattgcccgtgaa
gtggtcgagggcgggcgctttgcctgccagcaggccgggatcgcgctggcaggcggccat
tccattgacgctccggagccgatcttcggtctggcggtcaccggcgtggtgcccaccgag
cgcatcaagaaaaacagcactgcgcaggcgggctgcaaactgtatctcaccaaaccgctg
gggatcggtgtgctgaccaccgcggagaaaaaatcgctgctcaagccagagcatcaggga
ctggcgacggagaccatgtgccagatgaacctcgccggcgccgcgtttgccgccatcgac
ggggtgaaggcgatgaccgacgtcaccggctttggcctgctcggccatcttagcgaggtg
tgccgcggggccggcgtgcaggcgcagctgcgctatgccgatatcccaaaactgccgggg
gtggaaggctatattgccgccggcgcggtgccgggcggcaccgggcgcaactttgccagc
tacggccatctgatgggcgagatgccggcggagtggcgggacctgttgtgcgatccgcag
acctccggcggcctgctgctggcggtgactccggaagcggaagccgaagtccaggccgct
gcggcggagttcggcattaagctggccgccatcggcgagctggtcaccgcccgcggcgga
cgacccatgatcgagatccgttga

DBGET integrated database retrieval system