KEGG   Klebsiella variicola At-22: Kvar_3124Help
Entry
Kvar_3124         CDS       T01170                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00480  Glutathione metabolism
kva00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Kvar_3124
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Kvar_3124
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Kvar_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADC59009
Position
3257668..3258150
Genome map
AA seq 160 aa AA seqDB search
MTPFYQLTATRLRGQPLSMSDYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGG
RIKWNFTKFLIARDGTPLARFAPLTTPEKMEASIVAALTR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttttatcaattgacggctacccgcctgcgcggccagcccctctcaatgtct
gactatgctggcaaggtggttctggtggtgaatacggccagccattgtggcttcacaccg
caatacgctggcctggaagcgctctacaaaaagtacgcggctcaggggctggtagtgctt
ggtttcccgtgcaaccagtttggtaagcaggaacccggcggtgcggatgaaatcgagcag
acctgtcacgttaactacggcgtgagcttcccgatgtttgagaaagtggacgtcaacggc
cccgccgcacacccgctgtttcgttatctgaaacaagcgttgcccggcgtgctcggcgga
cggatcaagtggaatttcaccaagttcctcatcgctcgcgacggcacacccctcgcgcgt
tttgcgccgttgacgacgccggagaaaatggaggcctccattgtcgcggccctcacgcgc
tga

DBGET integrated database retrieval system