KEGG   Klebsiella variicola At-22: Kvar_3473Help
Entry
Kvar_3473         CDS       T01170                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00260  Glycine, serine and threonine metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kvar_3473
Enzymes [BR:kva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Kvar_3473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADC59353
Position
3637387..3638388
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMAAPVGDDVYGDDPTVNELQRYAADLAGKEAALFLPTGTQ
ANLVGLLSHCQRGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGSLPLDKVAAKI
KPDDIHFAPTRLLSLENTHNGKVLPRDYLQEAWAFTRQRDLALHVDGARIFNAVVAYGCE
LRDIAQYCDSFTICLSKGLGAPVGSLLLGSEAYIRRAIRWRKMVGGGMRQAGILAAAGLY
ALKNNVQRLQEDHDNAAWMAEQLRAIGADVTRHDTNMLFVRVGEAQAPALGEFMQARGVL
INASPVVRLVTHLDVNRQQLSEVVAHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagtgataccgttacccgtcccgggcgcgccatgctggaggccatg
atggccgccccggtcggggacgatgtgtatggcgacgaccctaccgtcaatgaactgcag
cgctatgccgccgacctcgccggcaaagaggcggcgctatttctgcccaccggcacccag
gccaacctcgttggcctgctcagccactgccagcgcggcgaagagtatatcgtcggccag
ggggcgcataactatctgtacgaagccggcggtgcggcagtactcggcagtattcagcca
cagccgattgacgccgcggcggatggttcgctgccgctggataaagtggcggcgaaaatc
aaacccgacgatatccattttgccccgactcgcctgctgagcctggaaaacacccacaac
ggtaaggtgctgccgcgcgactatctgcaggaagcctgggcgtttacccgccagcgcgac
ctggcgctgcacgtcgacggcgcgcgtatctttaacgccgtagtggcctacggctgcgaa
ctgcgtgatatcgctcagtactgcgactccttcaccatctgcctgtcaaaggggcttggc
gccccggtaggctcgctattgctgggcagcgaggcatacattcgccgtgctatccgctgg
cggaaaatggttggcggcggcatgcgccaggcgggcatactggccgctgccgggctgtac
gcgctgaaaaataacgtacagcgcctgcaggaggatcatgacaacgccgcgtggatggcg
gagcagcttcgcgccatcggcgccgacgtcacccgccatgataccaacatgctgtttgtg
cgcgttggcgaagcgcaggccccggcgctcggcgagtttatgcaggcgcgcggcgtgttg
attaacgcctcgcctgttgtccgtctggtcactcacctggatgtcaaccgtcagcagctg
agcgaggtggtcgctcactggcaggcttttttacagcgctaa

DBGET integrated database retrieval system