KEGG   Klebsiella variicola At-22: Kvar_4130Help
Entry
Kvar_4130         CDS       T01170                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00310  Lysine degradation
kva01100  Metabolic pathways
kva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Kvar_4130
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Kvar_4130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 Trp_halogenase Amino_oxidase FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: ADC60007
Position
4348279..4349547
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIEIYPDARIALLEKETGPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCEQNGIRYDVCGKMLVATSPLEMERMRALWDRTAANGLQREWLS
AGELREREPNITGLGGIFVPSSGIVSYRDVAAAMAKIFESKGGTIVYDAEVSALKEHASG
VVIRTRQGAEYEASTLIACSGLMADRLVKMLGVDPGFIICPFRGEYFQLAPQHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDISLADTLEILTSPGIRR
VLQNNLRAGLGEMKNSLCRSGYLRLVQKYCPSLTLSDLRPWPAGVRAQAVSPQGKLIDDF
LFVTTARSIHTCNAPSPAATSAIPIGAHIVSKVQTLLESQSNPGRTLRAARSVETLHAAF
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatttcgtgattatcggcggcggcatcatcggcatgtcgaccgccatgcagtta
attgagatttacccggacgcccgcattgcgctgctggaaaaagagaccggtccggcctgc
catcagactggccacaacagcggcgtgatccacgccggggtgtattacacccccggcagc
ctcaaggcgcagttttgcctcgccggcaaccgcgccaccaaggccttttgcgagcagaac
ggcatccgctatgacgtctgcggcaaaatgctggtcgccacctcgccgctggagatggag
cggatgcgcgccctgtgggatcgcaccgccgccaacggcctgcagcgcgagtggctaagc
gccggggagctacgcgagcgcgaaccgaacattaccgggctcggcgggatcttcgtccct
tccagcggcatcgtcagctaccgcgacgtggcggcggcaatggcgaagatcttcgaatca
aaaggcggaacgatcgtctacgacgccgaagtcagcgccctgaaagaacatgccagcggc
gtggtgatccgcacccgccagggcgccgaatatgaggcctccacgctgatcgcctgttcg
ggcttgatggccgatcggctggtaaaaatgctcggcgtcgatcccgggtttatcatctgt
ccgttccgcggcgagtatttccagctggcgccgcagcacaaccagatcgtcaaccatctg
atctatccgatccccgatccggcgatgccgttcctcggcgtccacctgacccgcatgatc
gacggcagcgtcaccgtcggccccaacgccgtgctggctctgaagcgcgaaggctaccgc
aagcgcgatatctcgctggccgataccctggagatcctcacctcgcccggcatccgccgg
gtactgcaaaacaacctgcgcgccggactgggcgaaatgaagaattcgctgtgcagaagc
ggctatctgcggctggtgcagaaatactgcccgagcctgacgctgagcgatttacgcccg
tggcccgccggcgtgcgggcgcaggcggtatcgccgcagggcaaactgatcgacgatttt
ctcttcgtcaccaccgcgcgttcgatacatacctgcaatgcgccatcgccggcggccacc
tccgctatcccgatcggcgcgcacatcgtcagcaaggtgcagaccctgctggaaagccag
agcaatcccggacgcacgctgcgtgcggcacgtagcgtggagacactacacgccgctttt
acccgttaa

DBGET integrated database retrieval system