KEGG   Klebsiella variicola At-22: Kvar_4336Help
Entry
Kvar_4336         CDS       T01170                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
kva  Klebsiella variicola At-22
Brite
KEGG Orthology (KO) [BR:kva00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Kvar_4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Pax2_C
Motif
Other DBs
NCBI-ProteinID: ADC60213
Position
4589560..4589937
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaattcgcctcgtgtttgcgttcaggtgcaaagcgtctatatcgaatcgcagtct
tctccggaagaagagcgttacgtcttcgcttataccgtcaccattcgcaatctggggcgg
agtcaggttcagctgcttggccgctactggctcatcactaacggccacggtcgtgagact
gaagttcagggtgaaggggtggtcggcgagcaaccacatattcccgctggcggtgaatat
caatataccagcggcgcggtcatcgaaacgccgctgggaaccatgcagggtcattatgag
atgatcgatatcgacggcgcgccgttccgtatcgagatccctgtgttccgtctcgcagtt
ccaacgctcattcattaa

DBGET integrated database retrieval system