KEGG   Klebsiella variicola At-22: Kvar_4840Help
Entry
Kvar_4840         CDS       T01170                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIA subunit
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00051  Fructose and mannose metabolism
kva01100  Metabolic pathways
kva02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Kvar_4840
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Kvar_4840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kva02000]
    Kvar_4840
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     Kvar_4840
Transporters [BR:kva02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    Kvar_4840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: ADC60711
Position
5145461..5145868
Genome map
AA seq 135 aa AA seqDB search
MVHAIFCAHGQLAGAMLDSVCMVYGEVNVSAVAFVPGENAADIAINLEKLVSAHTDEEWV
IAVDLQCGSPWNAAAGLAMRHPQIRVISGLSLPLALELVDNQHTLSADDLCQHLQAIASQ
CCVVWQQPETVEEEF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgctatcttctgcgcccacggccagctggccggggccatgcttgattcggta
tgcatggtctacggcgaggttaacgtcagcgccgtcgcgtttgtccccggcgaaaacgcg
gcggatatcgccattaacctggaaaagttagtaagcgcccacaccgatgaggagtgggta
atcgcggtagatttgcagtgcggaagcccatggaatgccgcagctgggctggcaatgcgt
cacccgcagatccgggtgattagcggcctgtcgctgccgctggcgctcgagctggtggat
aaccagcataccctgagcgccgatgacttatgccagcatctgcaggccatcgccagtcag
tgctgtgtggtctggcagcagccagaaaccgttgaggaggagttctga

DBGET integrated database retrieval system