KEGG   Klebsiella variicola At-22: Kvar_4892Help
Entry
Kvar_4892         CDS       T01170                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00071  Fatty acid degradation
kva00280  Valine, leucine and isoleucine degradation
kva00281  Geraniol degradation
kva00310  Lysine degradation
kva00362  Benzoate degradation
kva00380  Tryptophan metabolism
kva00410  beta-Alanine metabolism
kva00640  Propanoate metabolism
kva00650  Butanoate metabolism
kva00903  Limonene and pinene degradation
kva00930  Caprolactam degradation
kva01040  Biosynthesis of unsaturated fatty acids
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
kva01212  Fatty acid metabolism
Module
kva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Kvar_4892
   00650 Butanoate metabolism
    Kvar_4892
  Lipid metabolism
   00071 Fatty acid degradation
    Kvar_4892
   01040 Biosynthesis of unsaturated fatty acids
    Kvar_4892
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kvar_4892
   00310 Lysine degradation
    Kvar_4892
   00380 Tryptophan metabolism
    Kvar_4892
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kvar_4892
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Kvar_4892
   00281 Geraniol degradation
    Kvar_4892
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kvar_4892
   00930 Caprolactam degradation
    Kvar_4892
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Kvar_4892
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Kvar_4892
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Kvar_4892
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Kvar_4892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADC60763
Position
5218592..5220781
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQNDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETEAKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDKTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
cacgcgctggacgtactggaaaaacaaaacgatctcaaaggtctgctgctgcgctctgaa
aaagcggcgtttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggttgcattttgctaacagcgttttcaatcgtctggaagat
cttcccgtcccgacgatctctgccgtcaatggttacgcgctgggcggcggttgtgaatgc
gtcctggcgaccgattaccgcctggcgacgccggatctgcgtatcggtctgccggaaacc
aagcttggcattatgccgggcttcggcggttctgtgcgtctgccacgcttgcttggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaggcgctgaaa
atcggcctggtggatggtgtggtcgcagcggaaaaactgcgtgacggcgcgctggcgatc
ctgcgtcaggcgattaatggcgatctggactggaaagcaaaacgtcagccgaaactagag
ccgctgaagctcagcaaaattgaagctaccatgagcttcacgattgccaaaggcatggtc
gcgcaaacggccgggaaacattacccggcgccgatcaccgcggtgaaaaccattgaagcc
gccgcacgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagttgaccaaagatgtcgagacgccgaagcatgctgctgtcctgggc
gctggcattatgggcggcggtatcgcataccagtcggcctggaaaggcgtgccggtggtg
atgaaagacattagcgacaaatcgctgaccctgggcatgaccgaagcggcgaaactgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgatcagcacc
attcagccaaccctggaatacagcggttttgatcgcgtcgacgtggttgttgaagcggtg
gtcgaaaacccgaaagtgaagaaagcggtgctggccgaaaccgaggcaaaagtgcgcccg
gataccgtgctggcatccaacacctcaacaatccccatcagcgaactggccagcgttctg
caacgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataagaccattgccaaagttgtggcctgg
gccagcaaaatgggcaagacgccaatcgtggtgaatgattgtcccggcttcttcgtcaac
cgcgtgctgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggatttc
cgcaaggtcgacaaagtgatggaaaaacagtttggctggccaatgggcccggcctatctg
ctggatgttgtcggcatcgataccgcccaccatgctcaggccgtgatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgctgccgtcgacagcctgctggccgacgtcagccagccgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatcccgatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcacagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system