KEGG   Klebsiella variicola DX120E: KR75_00010Help
Entry
KR75_00010        CDS       T03531                                 

Definition
(GenBank) UDP-phosphate galactose phosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
kvd  Klebsiella variicola DX120E
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kvd01005]
    KR75_00010
Enzymes [BR:kvd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     KR75_00010
Lipopolysaccharide biosynthesis proteins [BR:kvd01005]
 O-antigen
  KR75_00010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: AJA93264
Position
1683458..1684894
Genome map
AA seq 478 aa AA seqDB search
MTHLAKNIGCTIALVVSDFISFVLSLYLAVGLLAVSMTDFETRVPGEQLDTWILLHLLLG
VCCVAWYGIRLRHYFYRKTFWYELKEILRTLIIFAVIEMAVMAFAKWYFSRYVWLLTWLL
AVFLVPLARMGTKWCLNKIGFWLRDTWIIGNGKNAIEAYKAIYSERNLGLKIVGFIDSGS
ASNNTHGTDVINGIEVIKASKDWLESIDRRTQFIVAVESTESETRNNWLREFMIKGYRYV
SVIPTLRGVPLDSTDMSFIFSHEVMIFRVQHNLAKWSSRIIKRLFDVVGSLGIIFILSPL
LIYISYKVKKDGGPAIYGHERVGKNGKPFKCLKFRSMVVNSKEVLENLLATDDSARHEWE
MTFKLKNDPRITKIGQLLRRTSLDELPQLFNVLKGEMSLVGPRPIITAELERYNDEVAYY
LLSKPGMTGLWQVSGRSDVDYDTRVYLDAWYVKNWSMWNDIAILFKTTTVVLKRDGAY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatttagcgaagaatataggctgcactattgccttagttgtgtctgattttatt
agttttgtgctttcattatatttagctgttggtcttttagctgtatcaatgactgatttt
gaaactagagttccgggtgaacaacttgatacttggattttgttacatttacttcttgga
gtgtgttgtgtcgcttggtatggtataaggcttaggcattatttttatcgaaaaacattt
tggtatgaactaaaagaaattttaagaacattaattattttcgctgttattgaaatggcg
gtgatggcttttgcgaaatggtatttttctcgctatgtttggctattaacttggcttttg
gctgttttcttagtaccgttagccagaatggggactaaatggtgtctaaataaaatagga
ttctggttgcgggatacatggataattggcaatgggaaaaatgcaatcgaagcttataaa
gctatatatagcgagcggaatttaggcttgaaaattgttggctttatcgatagtgggagt
gcgtcaaacaatactcatggaacagatgttattaatggtattgaggtaatcaaagctagc
aaggattggctggagtccattgataggcgaacacaatttattgttgcggttgaatcaaca
gaaagtgagactcgcaacaattggttacgtgagttcatgattaaaggctatagatatgtt
tcggttatacctactttaagaggtgttccactagacagtacagatatgtctttcatattt
agtcatgaagtaatgatttttcgtgttcagcacaatcttgcaaaatggtcatcaagaata
atcaaaaggctctttgatgttgttggatctctaggaattatattcattttatctccattg
ttaatatacattagttataaagtaaaaaaggacggtggacctgcaatatatggacatgag
agagttgggaagaatgggaaaccgtttaaatgtttgaagttcagatcaatggttgtaaat
tccaaggaagtgcttgaaaacttattggccaccgatgattcagcccgtcatgaatgggaa
atgacgttcaaattaaagaatgatcctcgcattacaaagataggacaactattaagaaga
acaagtcttgatgagttaccacagctcttcaatgtacttaaaggtgaaatgagcttggta
ggacctcgcccaattattactgcagaattagaacgctataatgatgaagtagcatattat
ttacttagtaaaccaggaatgacaggcctttggcaagttagtgggcgtagtgatgtagat
tacgatactcgggtctatttagatgcatggtatgttaaaaattggtcgatgtggaatgat
attgcaatactcttcaaaactacaactgtcgtattgaagagagatggtgcatattga

DBGET integrated database retrieval system