KEGG   Klebsiella variicola DX120E: KR75_03720Help
Entry
KR75_03720        CDS       T03531                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KR75_03720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kvd03400]
    KR75_03720
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KR75_03720
DNA repair and recombination proteins [BR:kvd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     KR75_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 SH3_13 UvrD-helicase AAA_22 DUF2075 AAA_28 UvrD_C T2SSE PhoH AAA_16 MukB CbiA AAA SRP54 NTPase_1
Motif
Other DBs
NCBI-ProteinID: AJA93967
Position
903592..905436
Genome map
AA seq 614 aa AA seqDB search
MTFEQLLLAAVEQRLLRPLDVQFALMVAQNDPPAVMLAAALLSRDAGEGHVCLPLSRLSG
DEALSGKAGEIRDRLLAEAGAPEDWPALLLASSAVSCGDAPAPMILCGDRLYLNRMWRNE
LTVARFFNEANRVLEMDEARLASTLNALFPATGETDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQIDDSPRCRIRLAAPTGKAAARLTESLGAALRKLPLTDAQKALIPTE
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPTHGRVIFLG
DRDQLASVEAGAVLGDICAWASSGYTAARAQELTRLTGSPVPAGEGTIAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFDDIALHPLSTTDEYEAMLGAAQQGYE
RYLQLRRERAEPQAMLAAFSEFQLLCALREGPYGVSGVNERLEQRLNRQRAIALPRHSRW
YDGRPIMISRNDSALGLFNGDIGIALERNGELRVWFLMPDGTIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALILPARSVPLVTRELVYTAITRAKQRLSLYADEQVLSQAIVTRTER
RSGLAEIFAGREAP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacaattactgctggcggcggtggagcagcgtctgctgcggccgctggac
gtccagtttgccctgatggtggcgcaaaacgacccgccggcggtcatgctggcggcggcc
ttgctgagccgggatgctggcgaggggcacgtttgcctgccgctctcgcggttgagcggc
gacgaggcgctgagcggaaaagcgggggagatccgcgatcggctgctggccgaagccggc
gcgccggaggactggcccgcgctgctgctcgcttcgtcggcggtgagctgcggcgatgct
ccggcgccgatgattttgtgcggcgaccggctctatctgaaccggatgtggcgcaacgag
ctgaccgtcgcccgcttctttaacgaagccaaccgggtgctggagatggatgaggcgcgg
ctggcgtcaacgctaaatgcgctgtttcccgccactggcgaaaccgactggcaaaaagtg
gccgcggcggtggcgctgactcgccgtatctcggtgatctccggcggtcccgggaccggg
aaaaccaccaccgtggcgaagcttctggcggcgctgatccagattgacgacagtccacgc
tgtcgtattcgcctggcggcaccgacggggaaagcggcggcgcgcctgaccgaatcgctg
ggcgcggcgctgagaaagctgccgctgaccgacgcgcagaaagcgttaattcccaccgag
gccagcacgctgcatcgtctgctgggcgcccagcccggcagccagcgcatgcgctatcac
gccggcaacccgctgcatctggacgtgctggtggtggatgaagcctcgatgattgacctg
ccgatgatgtcgcggcttatcgacgcgctgccgacccacgggcgggtgattttcctcggc
gatcgcgaccagctggcctccgtggaagcgggggcggtgctgggggatatctgcgcctgg
gcgagctcgggctacactgccgcgcgggcgcaggagctgacccggctgaccggttcgccg
gtgccggcgggcgaggggactatcgctggcgcgctgagagacagcttgtgcctgctgcaa
aagagctatcgcttcggcagtcactccggcatcgggagcctggcgcgggcggtgaatgct
ggcgcgcgcgcggaggtgaaggccacgctgcgccagccgtttgacgatatcgcgcttcat
cccctcagcacgaccgacgagtacgaggccatgctcggcgcggcccagcagggctatgag
cgctacctgcagctgcgccgcgagcgggccgaaccgcaggccatgctggccgctttcagc
gaattccagctgctgtgcgcgctgcgtgaagggccgtacggcgtgagcggcgtcaatgag
cggctggagcagcggctcaaccgccagcgggcgatcgccctgccgcgccactcccgctgg
tatgatggccgacctatcatgatatcgcgcaacgacagcgcgctgggactgtttaacggc
gatatcggcatagcgctggagcgcaacggcgagctgcgggtgtggttcctgatgcccgac
ggcaccatcaagtcggtgcaaccgagtcgcctgccggagcatgataccgcctgggcgatg
accgtgcataaatcgcagggctccgagttcgaacatgcggcgctgatcctgccggcgcgc
agcgtcccgctggtgacccgcgaactggtctacacggcgatcacccgcgcgaaacagcga
ttgtcgctctatgccgacgagcaggtgctctcccaggccattgtgacgcgcaccgagcgg
cgcagcggcctggcggagattttcgccgggcgcgaagccccctga

DBGET integrated database retrieval system