KEGG   Klebsiella variicola DX120E: KR75_19815Help
Entry
KR75_19815        CDS       T03531                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00071  Fatty acid degradation
kvd00072  Synthesis and degradation of ketone bodies
kvd00280  Valine, leucine and isoleucine degradation
kvd00310  Lysine degradation
kvd00362  Benzoate degradation
kvd00380  Tryptophan metabolism
kvd00620  Pyruvate metabolism
kvd00630  Glyoxylate and dicarboxylate metabolism
kvd00640  Propanoate metabolism
kvd00650  Butanoate metabolism
kvd00900  Terpenoid backbone biosynthesis
kvd01100  Metabolic pathways
kvd01110  Biosynthesis of secondary metabolites
kvd01120  Microbial metabolism in diverse environments
kvd01130  Biosynthesis of antibiotics
kvd01200  Carbon metabolism
kvd01212  Fatty acid metabolism
kvd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KR75_19815
   00630 Glyoxylate and dicarboxylate metabolism
    KR75_19815
   00640 Propanoate metabolism
    KR75_19815
   00650 Butanoate metabolism
    KR75_19815
  Lipid metabolism
   00071 Fatty acid degradation
    KR75_19815
   00072 Synthesis and degradation of ketone bodies
    KR75_19815
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KR75_19815
   00310 Lysine degradation
    KR75_19815
   00380 Tryptophan metabolism
    KR75_19815
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KR75_19815
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KR75_19815
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KR75_19815
Enzymes [BR:kvd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KR75_19815
Exosome [BR:kvd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KR75_19815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1853
Motif
Other DBs
NCBI-ProteinID: AJA97022
Position
complement(3015224..3016429)
Genome map
AA seq 401 aa AA seqDB search
MNKVYIVAACRTPVGRFLGALKTVSAVELAALTVRHNLQQAGIDPAWIDEVICGCVLAAG
QGMGPARQVALRAGIPVQKPAYTLNMICGSGMKSITEGAIHIQSGYADMVVAGGMENMSQ
APFLLRGEIRGGMKFGAFSSEDLIQSDGLTDPLLHIPMGETAEAIAAHEQISRAEQDQYA
LDSHQKASAASRAGHFAEEIVPVTVSAKRGVSVVREDEQIRHDLSADQLAALKPAFRRDG
SVTAGNASGLNDGAASVILASARAVAQYGLRPLAEIVAFGEGGVDPAMMGLGPLPAMTCA
LRRGRFQLSDMARLEINEAFAAQVLGVVKGLAREHQMTAEEIAARLNVNGGAIALGHPLG
SSGTRIVVSLLHALRRENKPTGLASLCIGGGMGIALIVKTI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgtatatcgtcgcggcctgccgtacgccggtggggcgttttcttggcgcc
ctgaaaacggtctctgcggtggaactggccgcgctcaccgtccgccacaacctgcagcag
gccgggattgacccggcgtggattgacgaagtgatctgcggctgcgtcctcgccgccggg
caggggatggggccggcgcgtcaggtcgcgctgcgggcggggatcccggtgcaaaagccg
gcttacaccctgaatatgatctgcggtagcggtatgaaaagtattaccgaaggggcgatc
catatccagagcggttatgccgacatggtcgtcgctggcgggatggaaaacatgagccag
gcgccgtttttgctgcggggagagataaggggcggcatgaaatttggcgcgttcagcagc
gaggatctgatccagagcgatggcttaaccgatccgctgttgcatattccgatgggggaa
acggcggaggccatcgccgcgcatgagcagatctcgcgcgcagaacaggaccagtacgcc
ctcgacagccatcaaaaagcctccgccgccagccgcgccggccattttgccgaggagata
gtgccggtgacggtcagcgcgaagcggggcgtcagcgtggtccgcgaggatgagcagatc
cgccatgaccttagcgccgaccagctggcggcgctgaaaccggcttttcgtcgcgacggg
agcgtcacggcgggcaacgcctcggggctgaacgacggcgcggcgtcagtgatcctcgcc
tcggcgcgcgccgttgcgcagtacggcctgcggccgctggctgagatagtcgccttcggc
gagggcggcgtcgacccggcgatgatggggcttgggccgctgccggccatgacgtgcgct
ctgcgccgcgggcgttttcagctcagcgatatggcgcgactggaaattaacgaagccttt
gccgcgcaggtgctgggggtggtcaaggggctggcccgcgagcatcagatgacggcggag
gagatagccgcccgcctgaacgtcaacggcggcgcgattgccctcgggcacccgctcggc
agttccggaacccggattgtcgtgagcctcctgcacgcgctgcgccgggagaataaaccg
accggcctggcctcgctgtgtatcggcggtgggatgggtattgcgttaattgtgaaaacg
atctga

DBGET integrated database retrieval system