KEGG   Klebsiella variicola DX120E: KR75_25165Help
Entry
KR75_25165        CDS       T03531                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00030  Pentose phosphate pathway
kvd00480  Glutathione metabolism
kvd01100  Metabolic pathways
kvd01110  Biosynthesis of secondary metabolites
kvd01120  Microbial metabolism in diverse environments
kvd01130  Biosynthesis of antibiotics
kvd01200  Carbon metabolism
Module
kvd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kvd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
kvd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KR75_25165
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KR75_25165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kvd04147]
    KR75_25165
Enzymes [BR:kvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KR75_25165
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KR75_25165
Exosome [BR:kvd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KR75_25165
  Exosomal proteins of colorectal cancer cells
   KR75_25165
  Exosomal proteins of bladder cancer cells
   KR75_25165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AJA98032
UniProt: A0A0B7G3T0
Position
1924968..1926443
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHADTRIIGVGRADWDKAAYTK
VVREALETFMKEKIDEGLWDSLSGRLEFCNLDVNDTSGFTRLGEMLDQQNRVTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLETSREINDQVGEFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDCRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKTSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KETWQELPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADRDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacggcccaggcatgcgacctggtcattttcggcgcgaagggcgac
ctggcgcgacgtaaattgttgccttccctgtatcagcttgaaaaagcgggccagatccac
gccgacacccgcatcattggcgtcggccgtgccgattgggataaagcggcttacaccaaa
gtcgtgcgcgaagcgctggaaaccttcatgaaggaaaaaattgatgagggtttgtgggat
tccctgagcggacgcctggagttctgtaatcttgacgtcaatgacaccagcggcttcacg
cgtctgggtgagatgctggatcaacagaaccgtgtcaccatcaactatttcgccatgccg
ccgagcacctttggcgcgatctgcaaaggtctgggcgaagcgaagctcaatgccaagcct
gcgcgcgtggtgatggaaaaaccgctgggtacctcgctggaaacctcgcgtgaaatcaat
gaccaggtcggcgagttttttgaagagtgccaggtctaccgtatcgaccactacctcggt
aaagagacggtcctcaacctgctggcgctgcgctttgccaactctctgttcgtcaataac
tgggactgccgcactatcgaccatgtcgaaatcaccgtcgcggaagaggtgggtattgaa
gggcgctggggttacttcgaccaggccgggcagatgcgcgacatgatccagaaccacctg
ctgcagatcctgtgcatgattgccatgtcaccgccgtccgatctcagcgccgacagcatc
cgtgatgaaaaggtcaaggtcctgaaatccctgcgccgcattgatcgctccaacgtgcgt
gagaaaaccgttcgcggccagtacaccgccggctttgcccagggcaaaaaagtcccgggt
tacctggaagaagagggcgccaacaaaaccagtaacaccgaaaccttcgtggcgatccgc
gtcgatatcgataactggcgctgggccggcgtaccgttctatctgcgcaccggcaaacgt
ctgccgaccaaatgctctgaggtagtggtttacttcaaaactccggagctgaacctgttt
aaagagacctggcaggagctgccgcagaacaagctgaccattcgtctgcagccggacgaa
ggggtggatatccaggtgctgaacaaagtgccgggcctcgaccataagcataatctgcag
atcaccaagctggatctgagctactccgagaccttcaaccagacgcacctggccgatgct
tatgagcgtctgctgctggagaccatgcgcggtatccaggcgctgttcgtgcgccgtgat
gaagtggaagaggcgtggaaatgggtggattccatcaccgaagcctgggctgccgaccgc
gatgcgccgaaaccgtatcaggcagggacctggggaccggttgcgtcggtggcgatgatc
acccgtgacggccgctcatggaacgagttcgagtaa

DBGET integrated database retrieval system