KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0028Help
Entry
KVU_0028          CDS       T01909                                 

Gene name
hemN
Definition
(RefSeq) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00860  Porphyrin and chlorophyll metabolism
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KVU_0028 (hemN)
Enzymes [BR:kvl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     KVU_0028 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-GeneID: 12372858
NCBI-ProteinID: YP_005793863
UniProt: F9Y7Q1
Position
36696..38045
Genome map
AA seq 449 aa AA seqDB search
MTHYAFKHLGLFDAHVPRYTSYPPANHFDTLAPSQSESWLKTVPRSGHIAIYVHIPYCRR
LCWFCADHTHGLMTDRPLRRYLDHILAELALIAGYLPPDVRVASVHLGGGTPTILSAEML
SELGQALRDFRPFTRTARISVEIDPAAVDDARLDALAQIGMNRAAIGVQGFDPRVQTVTG
RVQPFAVTRKAVAGLRARGVGCVTMDVLYGLPYQTPDSMTQTIEKVMDIRPDRLALFGHG
HAPLRSRRQVMIEDAALPDPQARLALFEAARRQLLDGGYHPVGIDHFCLPGDSLAFAAEI
GSLRRNFQGYTEENADALIGIGASSISRFAQGYAQNVAAISDYGAHVAAGRLPTARGHRF
TSDDLLRGAMIEELLCNFSVDIATHARRFDRPIEAVEAIVLPLLSTFHAHLVKDGSRIEL
IGPARHLARMAAQTMDAYVAPEGRHSRAI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgacacattatgcgtttaagcatcttggtctgtttgacgcgcatgtgccgcgctatacc
agctatccacctgccaatcatttcgacacgcttgcgccgtcgcaaagcgaatcgtggcta
aaaacggtgccgcgcagcggccatatcgcgatttacgtgcatattccttattgtcgccgc
ctgtgttggttctgtgccgatcacacgcatggcctgatgacggatcgtcccttgcggcgt
tatctggaccatattctggccgagcttgctttgatcgcgggctatttgccacccgatgta
agggtggcctcggtgcatctggggggcggcacacccacgatcctgtcagcggaaatgctg
tcagagctggggcaggccctgcgtgattttcgcccctttacccgcactgcccgtatttcg
gtcgagattgacccggccgcagtggacgatgcgcgtctggatgctcttgcccaaatcggg
atgaatcgcgcggcgatcggggttcagggtttcgaccctcgggtgcaaaccgtcacgggg
cgcgtgcagccgttcgcggtcacgcgcaaggccgtcgctggcctgcgcgcgcggggggtt
ggctgtgtgacgatggatgtgctttacggccttccctatcaaacgcccgatagtatgacg
caaacgattgaaaaggtgatggatattcgcccggaccggctagccctatttggccatggg
catgccccattgcgcagccgccgtcaggtgatgatcgaggatgctgcgctgccggacccc
caagcccgccttgccctgttcgaagctgcgcggcgtcagttgctggacggtggttatcat
ccggtcggtatcgatcatttctgcctgcccggtgacagcctggcttttgccgccgagatc
ggcagcctgcgccgcaatttccaggggtataccgaggaaaatgccgatgcgttgatcggg
attggcgcctctagcatttcgcgctttgcgcagggctatgcgcaaaatgtggcggcgatc
tcggattacggggcccatgtggccgctgggcgattgccaacggcgcgggggcataggttc
acctctgacgacctgctgcgcggcgcgatgatcgaggaattgctgtgtaatttcagcgtc
gacatcgccacccatgcgcgccgctttgaccgcccgatcgaggcggtcgaggcaattgtc
ctgccgcttttatccacctttcatgcgcatctggtaaaagacggcagccggatcgagctg
atcggccccgctcggcatctggcgcggatggcggcacagacgatggatgcctatgtcgca
cccgaaggacggcattcccgcgcgatttag

DBGET integrated database retrieval system