KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0537Help
Entry
KVU_0537          CDS       T01909                                 

Gene name
metG
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00450  Selenocompound metabolism
kvl00970  Aminoacyl-tRNA biosynthesis
kvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KVU_0537 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KVU_0537 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kvl01007]
    KVU_0537 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kvl03016]
    KVU_0537 (metG)
Enzymes [BR:kvl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KVU_0537 (metG)
Amino acid related enzymes [BR:kvl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KVU_0537 (metG)
Transfer RNA biogenesis [BR:kvl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KVU_0537 (metG)
 Prokaryotic type
   Other AARSs
    KVU_0537 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 12373387
NCBI-ProteinID: YP_005794372
UniProt: F9Y3D5
Position
complement(582222..583931)
Genome map
AA seq 569 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLYARYQRGRGHEVMFLCATDEHGTPAEIAA
AKAGKPVAEYCAEMHDVQAEIAKGFRLSFDHFGRSSSAQNHKLTQHFAGVLAERGFIREV
TEMQMYSPTDGRYLPDRYIEGTCPNCGFPDARGDQCDNCTKQLDPVDLINPRSAISGATD
LEMRETKHLYLCQSQLQDKIAAWIDSKTDWPVLTTSIAKKWLTDGDGLQDRGITRDLDWG
IPVKKGDADWPGMEGKVFYVWFDAPIEYIASAQEWVDAGKGVDWERWWRTDKGADDVTYT
QFMGKDNVPFHTLTFPATILGSGEPWKLVDYIKSFNYLNYDGGQFSTSRGRGVFMDQALS
ILPADYWRWWLLSHAPETSDSEFTWDNFQMSVNKDLADVLGNFVSRVTKFCRSKFGEVIP
EGGTWGARENALIAELTQRLQAYEGFMDAMEVRKASSELRAIWVAGNEYLQSAGPWTTIK
TDTETAAMQTRLGLNLIRLYAVLSAPFIPDASATMLAAMKTADDQWPTDITGFLTALPAG
HAFEVPEVLFGKITDEQREDWQVRFAGTR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcatcttatcacctcggctattccctatatcaacgggatcaagcatctgggc
aatctggtgggaagccagctgcctgcggatctttatgcgcgatatcagcgggggcgcggt
catgaggtgatgttcctctgcgcaaccgatgaacacggcacgcccgccgagattgctgcc
gccaaagccggtaaacccgtcgcggaatactgcgccgagatgcatgatgtgcaggccgag
atcgcgaaaggcttccgcctgtcgttcgaccatttcggccgctcgtccagcgcgcagaac
cacaagctgacccagcatttcgcaggcgttctggccgagcgcggctttatccgcgaagtg
accgaaatgcagatgtattcgccgaccgatggccgctatctgcccgaccgctatatcgag
ggcacctgccccaattgcggctttcccgacgcgcgcggcgatcaatgcgacaattgcacc
aagcagcttgatccggtcgatctgattaacccgcgctcggcgatctcgggcgcgaccgat
ctggaaatgcgcgagacgaagcacctctacctgtgccaaagccagctgcaggacaagatc
gcggcatggatcgacagtaagaccgactggccggtgctgacgacctcgatcgcaaagaaa
tggctgacggatggcgacgggctgcaagatcgcggcatcacgcgcgatctggattggggc
attccggtgaaaaagggcgatgcggactggcccggcatggagggcaaagtcttttacgtc
tggttcgacgcccccatcgaatatatcgccagcgcgcaagaatgggttgatgccggtaag
ggcgtggattgggagcgctggtggcgcaccgacaagggcgccgatgacgtgacctatacc
cagttcatgggcaaggataacgtccccttccacacgctgaccttccccgccacgatcctg
ggttcgggcgagccgtggaagctggtcgattacatcaagtcgttcaactatctgaattat
gacggcggccaattctcgacctcgcgcgggcgcggcgtgttcatggatcaggctttgtcg
atcctacccgctgactactggcgctggtggctgctgtcacatgcgcccgagacctcggat
tccgaattcacctgggacaatttccagatgtcagtgaacaaggatctggccgatgtgctg
ggcaattttgtcagccgcgtcaccaaattctgccgcagcaaattcggcgaagtcatcccc
gagggtggcacctggggcgcgcgtgagaacgccctgatcgccgagctgacccagcgcctt
caggcctatgagggctttatggatgcgatggaggtgcgcaaagcctcatccgagctgcgc
gcgatctgggttgcgggcaatgaatacctgcaatcggcaggtccctggaccacgatcaaa
accgataccgagaccgccgccatgcagacgcgtctgggtctgaacctgatccgtctttat
gccgtgctatccgcgccctttatccccgatgcatcggccacgatgctggcggcgatgaag
accgcggatgatcaatggcccacagatatcaccggtttcctgacggccctgcccgcaggc
catgcatttgaggtgcccgaggtgctgttcggcaaaatcaccgacgagcagcgcgaagac
tggcaagtgcgctttgccggaacgcgctaa

DBGET integrated database retrieval system