KEGG   Ketogulonicigenium vulgare WSH-001: KVU_1046Help
Entry
KVU_1046          CDS       T01909                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00900  Terpenoid backbone biosynthesis
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01130  Biosynthesis of antibiotics
Module
kvl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KVU_1046 (dxr)
Enzymes [BR:kvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KVU_1046 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 12373913
NCBI-ProteinID: YP_005794881
UniProt: F9Y6D9
Position
complement(1098857..1100017)
Genome map
AA seq 386 aa AA seqDB search
MRKVSIFGATGSVGQSTLDLIARAPGDYAVEVLTGGRNIAQLADDAVKFHAKLAITCEDD
LLPDLRAALAGTGVDVAAGAAAIAEAATRPVDWAMSAIVGVAGLVPGLNIIGQGATLGLA
NKETLVAAGPLVVARAAAHHATIIPVDSEHSAIFQALHGEDLAAVERVIITASGGAFRDA
TLAEMAQATPEQAATHPNWAMGQRITIDSASMFNKALEMIEAREFFGLSPDQIEVVVHPE
SLIHALVGFQDGALMAHVGPPDMRHAIGYALHWPARKTLPVERLDLVKIGQMTFRAADPD
RYPALRLARQVMAQGGYAGAVFNAAKERALDRFLNRDLAFLDMAAAVEHVLDQMDRAGLL
AGDSLSLDQVLAMDAEARARVDGYKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaaggtttctattttcggcgcgacggggtcggtggggcaaagcacgctggatctg
attgcgcgtgcgccgggcgactatgcggtcgaggtgctgaccggcggtcgcaatatcgcg
caacttgcggatgatgctgtaaaattccacgcaaaacttgcgatcacctgcgaagatgat
ttgctgcctgacctgcgcgcggcgctggcgggcactggcgtcgatgttgccgcaggcgcc
gccgccattgccgaggctgcaacccgtcccgtcgattgggcaatgtctgcgattgtcggt
gttgcggggctggtgccggggctgaacattatcgggcagggcgcgacactcggccttgcg
aataaagaaacattggttgccgcaggccccttggtggtggcgcgggcggccgcgcatcat
gccacgatcatccccgtcgatagcgaacatagcgccatctttcaggcgctgcacggcgag
gatctggccgcggtcgagcgtgtcatcatcaccgcatcgggcggcgcatttcgtgatgcg
acgctggccgagatggcacaagccacccccgaacaggcggcaacccatcccaattgggct
atggggcagcggatcacgatcgattccgcctcgatgttcaacaaagcgctggaaatgatc
gaggcgcgcgaattctttggccttagccccgatcagatcgaggttgtcgtccatcccgaa
agcctgatccacgctttggtcggctttcaggatggcgcgctgatggcccatgtcggcccg
cccgatatgcgtcacgccattggttatgccctgcactggcccgcgcgtaaaacgctgccg
gttgagcggcttgatctggtgaaaattggccagatgacgtttcgcgcggctgacccagac
cgctatcctgcgctgcgccttgcgcggcaggtgatggcgcagggcggctatgccggtgct
gtgttcaacgccgccaaggaacgcgcgcttgaccgctttctcaatcgtgatctggctttt
ctggacatggccgctgcggtggaacatgtgctggatcagatggatcgtgcagggcttttg
gcgggcgatagtctatcgcttgatcaggtcttggccatggacgccgaggcgcgcgcccgc
gtcgatggatataaaggatag

DBGET integrated database retrieval system