KEGG   Ketogulonicigenium vulgare WSH-001: KVU_1298Help
Entry
KVU_1298          CDS       T01909                                 

Definition
(RefSeq) phosphate transport permease protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KVU_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HR_lesion
Motif
Other DBs
NCBI-GeneID: 12374173
NCBI-ProteinID: YP_005795133
UniProt: F9Y811
Position
complement(1371454..1372950)
Genome map
AA seq 498 aa AA seqDB search
MTDRSSLNQAEGPTHEWAALDRDLNRISRVEDATFYIARPMVGFGLAIVFVALAALWAAI
IVGGAPGGVMIIVASVFAAYLALNIGANDVANNMGPAVGANALSMTGALVIAAVCETAGA
LIAGADVVGTIANGIVAPSSFANSDIFVIAMISALLSSAVWINLATFLGAPVSTTHAIVG
GVVGAGIAAAGFGAVDWGGIGRIAASWVVSPVLGGVMAAASLALVHRLVIDRADKIAAAR
VWVPVLIGIMAWAFGAYLAVKGLKQIVHVSMAGALLIGAALGVISYLASRPYIARKSIGL
ENRNKSLKVLFQLPLVVSAALMSFAHGANDVSNAIGPLAAIVQTLGLNGADVGSIPLWVM
VIGALGISLGLLLFGPKLISMVGDQITKLNAMRAYCVALSAAVTVIAASWLGLPVSSTHI
AIGGIFGVGFYREWGEARRMSRGLETEAAPAIANEERRRRRLVRRSHFLTIVAAWIITVP
ATALLSALGFLALRLLMG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaccgttccagtctgaaccaagccgagggcccgacccatgaatgggcggccctc
gaccgcgatctgaaccgtatctcgcgcgtcgaggacgccaccttttacatcgcgcgcccg
atggttgggtttggccttgccattgttttcgtggcattggcggcgctatgggcggcgatt
atcgtcgggggtgcgccgggcggcgtgatgattatcgtcgcctcggtctttgcggcctat
ctggcgctgaatatcggcgcgaatgatgtggccaataatatggggccagcggtgggcgcg
aatgccctgtcgatgaccggcgcgctggtcatcgccgccgtgtgcgagacggcgggcgcg
ctgatcgcaggcgcggatgttgtcggcactatcgccaatggcatcgttgcgcccagcagc
tttgccaatagcgatattttcgtcattgccatgatctcggccctgctgtcctcggcggtc
tggatcaatctggcgacgtttctgggcgcgccggtttctaccacccatgcgattgttggc
ggcgttgttggggccgggatcgcagcggcgggttttggtgcggtggattggggcggcatc
ggtcgcatcgccgcaagctgggtcgtatcgcccgtcctcggcggagtaatggcggcggcc
agccttgcgctggtgcatcggctggtgatcgaccgggccgataagatcgctgcggcgcgg
gtctgggtgccggtgctgatcggcatcatggcttgggcctttggcgcctatctggcggtc
aaggggctcaagcagatcgtgcatgtctcgatggccggtgcgctgttgatcggcgcggcg
ctgggcgttatcagctatctggcgtcgcggccctatattgcgcgcaaatccatcggcctc
gagaaccgtaacaaatcgctgaaagtgctgttccaactgccactggtcgtgtcagccgcg
ctgatgagctttgcgcatggggccaatgacgtctcgaatgcgattgggccgctggcggcg
attgtgcagacgctggggctgaatggcgcggatgtcggatcgatcccgctgtgggtcatg
gtcatcggcgcgctgggcatctcgctggggctgctgctgtttgggccgaaactgatcagc
atggtgggcgatcagatcaccaaactgaacgcgatgcgggcctattgcgtggcgctgtcg
gccgcggtgacggtgattgcggcttcgtggctggggctgccggtcagctcgacccatatc
gcgattggcggcattttcggcgtcggattctaccgcgaatggggcgaagcgcgccgcatg
agccgcggattggaaaccgaagccgcgcctgccatcgctaatgaggaacgccgccgtcgc
cgccttgtgcgtcgctcgcacttcctgacgattgtggcggcttggatcatcacagtgccc
gcgacggcgctgctgtcggcgcttggtttcctcgcgctgcgcctgctgatgggctaa

DBGET integrated database retrieval system