KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2133Help
Entry
KVU_2133          CDS       T01909                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase 1
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00300  Lysine biosynthesis
kvl01100  Metabolic pathways
kvl01120  Microbial metabolism in diverse environments
kvl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KVU_2133 (dapE)
Enzymes [BR:kvl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KVU_2133 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 12375055
NCBI-ProteinID: YP_005795968
UniProt: F9Y5P7
Position
complement(2247917..2249059)
Genome map
AA seq 380 aa AA seqDB search
MSFDAVKLTADLIKCPSVTPHEGGALVLLERALTDAGFACTRVDRGGISNLFARWGRKGA
NRSFGFNGHIDVVPVGDASQWTFDPFGAEIVDGYMYGRGAVDMKSGVAAFVGAAIDFTRN
TPPDGAIVLTITGDEEDVGEDGTRALLDWMAENGEAMSVCIVGEPTSPEVLGDMMKIGRR
GSATVWFTVTGQQGHAAYPQRALNPMPAMARLMDRLSSRVLDEGTDHFDSSSLQVVTIDT
GNGATNVIPGQTRATINVRFNDIHTGASLVDWMQAEADKVAAEFGVQVALRSRISGEAFL
TPPGALSDLVAAAVKAETGLSPVLSTSGGTSDARFVKSHCPVVEFGLVGKRMHGVDERVE
IVQIGQLQAIYTRVLADYFA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgatgccgtcaaactgaccgccgatctgatcaaatgtccctcggtcaccccg
catgaggggggggcgttggttctgctggaacgcgcgctgacagatgccggtttcgcatgc
acccgcgtcgatcgcggcggcatcagcaacctgtttgcccgctggggccgcaagggcgcg
aaccgcagcttcggctttaacggccatatcgacgtggtgccggtgggcgatgccagccag
tggacgtttgatccgttcggggcggaaattgtcgacggctatatgtatgggcgcggcgcg
gtggatatgaaatcgggcgtcgcggcctttgtcggcgcggcgattgatttcacgcgcaat
accccgcctgatggcgcgattgtgctgaccattaccggcgacgaggaagacgtcggcgag
gatggcacccgcgccttgctggattggatggccgagaatggcgaggcgatgtccgtctgc
atcgtgggcgagccgaccagccccgaagttttgggcgatatgatgaaaatcggccgtcgc
ggctcggccacggtatggttcacggtgacgggtcaacagggccatgcggcctatccgcag
cgcgcgctgaacccgatgcccgcgatggcgcggctgatggataggttgtcgtcgcgcgtg
ctggacgagggcaccgatcacttcgactcgtcctcgctgcaggttgtgacgattgatacc
ggcaacggcgcaacgaatgtgatcccgggccagacgcgcgccacgatcaatgtgcggttc
aacgacatccacaccggcgcgagccttgtcgattggatgcaggccgaggcggataaagtc
gccgccgaattcggtgtgcaagtggctctgcgcagccgcatctcgggcgaagcgttcctg
accccgcccggcgcgctgtcggatctggtggcggcggcggtcaaggcggaaaccggactg
tcaccggtgctgtcgaccagcggcggcacatcggatgcgcgtttcgtgaaatcgcattgc
cccgtcgtggaattcggccttgtcggcaagcggatgcacggcgtcgatgaacgggtcgag
atcgttcagatcggccagctgcaagcaatttatacccgcgtgctggccgattatttcgcc
tga

DBGET integrated database retrieval system