KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2457Help
Entry
KVU_2457          CDS       T01909                                 

Gene name
sucC
Definition
(RefSeq) ATP-dependent carboxylate-amine ligase-like protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00020  Citrate cycle (TCA cycle)
kvl00640  Propanoate metabolism
kvl00660  C5-Branched dibasic acid metabolism
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01120  Microbial metabolism in diverse environments
kvl01130  Biosynthesis of antibiotics
kvl01200  Carbon metabolism
Module
kvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2457 (sucC)
   00640 Propanoate metabolism
    KVU_2457 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KVU_2457 (sucC)
Enzymes [BR:kvl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KVU_2457 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 12375397
NCBI-ProteinID: YP_005796292
UniProt: F9Y7K0
Position
complement(2600386..2601603)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQAKGLLRDYQIPVGAGQIILNSRDADQAAAALQGPLWVVKAQIHAGGRGKGHFI
EEAAGAGGGVRLARSASEAAQIARQMLDNTLVTVQTGPKGRKVGRVYLEAGADIARELYL
ALLIDRKTSRISFVCSTEGGVDIEHVAATTPEKVITIAVDPATGFQQWHGRAIAFALELS
GAQIKECVALTGNLYRAFTERDMEMLEINPLIVTPAGHLHCLDAKVGFDNNALYRHPEIA
ALRDEAEEDEKELAASKFDLNYITLDGSIGCMVNGAGLAMATMDIIKLYGSAPANFLDVG
GGASKEKVTEAFKIITSDPNVQGILVNIFGGIMRCDIIADGIIAAVREVGLQVPLVVRLE
GTNVEIGKDIIRNSGLNVIPADDLADAAQKIVAAVKDATHKAAEA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaggcaaaaggccttttgcgtgattaccagatccccgttgga
gcgggtcagatcatcctgaacagccgtgatgccgaccaagctgcggccgcgctgcagggc
ccgctatgggtggtaaaggcgcaaatccacgcaggtggtcgcggcaaaggccatttcatc
gaggaggccgcaggtgccggcggcggtgtccgcctcgcgcgctcggcgtccgaggccgcg
cagatcgcgcgccagatgctggacaacacccttgtcaccgtgcagaccggccccaagggt
cgcaaagtcggccgcgtctatcttgaagctggcgccgatatcgcgcgcgagctgtatctg
gcgctgctgatcgatcgcaaaacctcgcgcatctcgttcgtttgttcgaccgagggcggc
gtcgatatcgaacatgtcgctgcaacgacgccggaaaaggtcatcaccattgcggtcgat
cccgcgacgggtttccagcaatggcatggccgcgccattgcctttgcgctggaactgtcc
ggcgcgcagatcaaggaatgcgtcgccctgaccggcaatctttaccgcgccttcaccgag
cgcgacatggagatgctcgagatcaatcccctgatcgtgacgccagcgggccatctgcac
tgcctcgacgccaaggtcggttttgacaacaacgccctttatcgtcaccccgaaatcgcc
gccctgcgcgacgaggccgaggaggacgaaaaggagcttgctgcgtccaaattcgatctg
aactatatcacgctggacggcagcatcggctgcatggtcaacggcgcgggccttgcgatg
gcgacgatggatatcatcaagctctatggttcggcgcccgcgaactttctggatgtcggc
ggcggcgccagcaaagaaaaggtgaccgaggcgttcaagatcatcacctctgaccccaat
gtgcaggggattttggtgaacatctttggcggcatcatgcgctgcgatatcatcgccgac
ggtatcattgccgccgtgcgcgaggttggcctgcaagtgccccttgtcgtccggttggag
ggcacgaatgtcgaaatcggcaaggatatcatccgcaattccggcctgaacgtgataccc
gcagacgatctggcggatgcggcgcaaaagatcgtcgcggcggtcaaggatgcaacccat
aaggcagcggaggcttga

DBGET integrated database retrieval system