KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2461Help
Entry
KVU_2461          CDS       T01909                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00020  Citrate cycle (TCA cycle)
kvl00190  Oxidative phosphorylation
kvl00650  Butanoate metabolism
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01120  Microbial metabolism in diverse environments
kvl01130  Biosynthesis of antibiotics
kvl01200  Carbon metabolism
Module
kvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2461 (sdhD)
   00650 Butanoate metabolism
    KVU_2461 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KVU_2461 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF766
Motif
Other DBs
NCBI-GeneID: 12375401
NCBI-ProteinID: YP_005796296
UniProt: F9Y7K4
Position
2603865..2604248
Genome map
AA seq 127 aa AA seqDB search
MRYLTDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVG
RPFPLIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIARGLSWLLIATGLLALVR
LALGQPS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacggatcgcaaacgtgccgttggcaatggcgcatcgcgcacgggcacg
tttgaccatattttcatgacctcgacatcttatggcttgctggtgctggtgccttgcctg
gtctgggtgctggggaatgcgctgttcctgccgtttgatcaggcgcgcgcctatgtcggt
cggccgtttccgctgatcgtcttgggtttgacgctggtggtcggtctgcgccactttgct
gtcggcgcacagatgatgctggaagattacctgcagggctttgcccgtgaaattaccgtg
ctgatcgcccgcggcctgtcgtggctgctgatcgcgaccggcctgttggcgctggtgcgt
ctggcgctgggccaaccttcatga

DBGET integrated database retrieval system