KEGG   Ketogulonicigenium vulgare WSH-001: KVU_PA0258Help
Entry
KVU_PA0258        CDS       T01909                                 

Definition
(RefSeq) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00430  Taurine and hypotaurine metabolism
kvl00460  Cyanoamino acid metabolism
kvl00480  Glutathione metabolism
kvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KVU_PA0258
   00460 Cyanoamino acid metabolism
    KVU_PA0258
   00480 Glutathione metabolism
    KVU_PA0258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kvl01002]
    KVU_PA0258
Enzymes [BR:kvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     KVU_PA0258
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     KVU_PA0258
Peptidases and inhibitors [BR:kvl01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   KVU_PA0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 12376019
NCBI-ProteinID: YP_005796886
UniProt: F9YBC3
Position
p1:257087..258595
Genome map
AA seq 502 aa AA seqDB search
MTAAIATPHPLATAAGQKVLDAGGTAPEAVIAAGAVLTVVMPHFCGLGGDAVWTLSDRNG
DSRCLLAIGQGIQRDRPKGPVPFRGPASILTTAAVVDGWAEALDYAHVHLGGRASWQSLL
AQAFALAWDGFAVTSSQGYWTDFRAPEIADWPGFDGLFLQNGASLPVGHLLQQPDLACVF
AKLIDNGPRDFYEGAVAARIIAGLQETGAIIGADDLRQTRSRWAAPVSLGYRGHRLLSSP
PPTQGLTTLQIMGILAQFDLADIAPSSAAHFHLCVEAVKRAFEDRGRIADGAAVDDLLAP
DHLGARAADISTQQAMAWPHPWQHGDTVFLGAIDAMGNAASMLQSTFYDWGSGVVVPGTG
IIWQNRGAAFSFQPGHPNMFRPGKLPFYTLNPGIALDDAGRPAFVYGTQGADGQPQTLAM
LLSLLLDYGLPPDQALAAPRFLLGRTFSDQRDSLKVEGHAGDAVIAQLKTLGHQVSAIAP
LSPLAGQAGVISPTLGGHHDPR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcaattgcgacgccgcatccgctggcgacggcggcgggtcaaaaagtgctg
gacgctggtggcaccgcgcccgaggcggtcattgccgccggggccgtgctgacggtggtg
atgccgcatttttgcggtcttggtggcgatgcggtttggacgctgagtgatcgcaatggc
gatagtcgctgtctgctggccatcgggcagggcatccagcgcgataggcccaaggggccg
gtgccgtttcgcgggccggcgtccatcctgaccaccgccgctgtggtcgatggttgggcc
gaggcgctggattacgcgcatgtgcatttgggcggccgggcgtcgtggcaatcgctgttg
gcccaagcattcgcgctggcgtgggatgggtttgcggtgacctcctcgcagggctattgg
actgattttcgcgcgcctgagattgcggattggccgggctttgacgggctattcttgcaa
aacggcgcatcgctgccagtggggcatctgctgcaacagcctgatcttgcctgcgttttc
gccaagctgatcgacaatggcccgcgagatttttacgagggggctgtggcggcgcggatc
attgcggggctgcaagagaccggcgcgatcatcggggcggatgatctgcgtcagacgcgc
agccgctgggcggcgccggtcagcttgggctatcggggccataggctgctgtcctcgccg
ccgccgacccaagggctgacgacgctgcagatcatgggaattctggcgcagttcgatttg
gcagatatcgcccccagcagcgccgcacattttcacctgtgtgtcgaggccgtcaaacgc
gcctttgaggatcgcggccgtattgcggatggcgcggccgtggatgacctacttgcgccg
gatcatctgggcgcgcgcgcggcggatatttcgacgcaacaggccatggcctggccgcat
ccgtggcagcatggtgatacggttttccttggcgcgatcgatgcgatgggcaatgcggca
agcatgctgcaaagcaccttttatgactggggcagtggcgttgtggtgccgggcaccggc
atcatctggcaaaaccgcggagcggctttcagctttcagcccggtcatccgaatatgttc
cggcccggcaagctgccgttttacacgctgaaccccggcatcgcgctggatgatgcgggc
cgcccggcctttgtctatggcacacagggcgcagatggccagccgcagaccttggccatg
ctgctcagtctgctgctggattacggcctgccgcctgatcaggcgctggctgcgccccgc
tttttgctggggcgcaccttttctgatcaacgcgacagtctgaaggttgaggggcatgca
ggcgatgcggtgatcgcgcagctaaagaccctcggccatcaggtcagcgcgattgcaccg
ctcagcccgcttgcggggcaggcgggcgtgatcagccccacgctgggcggacatcacgat
ccgcgttga

DBGET integrated database retrieval system