KEGG   Klebsiella variicola DSM 15968: SP68_03875Help
Entry
SP68_03875        CDS       T03641                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00071  Fatty acid degradation
kvq00072  Synthesis and degradation of ketone bodies
kvq00280  Valine, leucine and isoleucine degradation
kvq00310  Lysine degradation
kvq00362  Benzoate degradation
kvq00380  Tryptophan metabolism
kvq00620  Pyruvate metabolism
kvq00630  Glyoxylate and dicarboxylate metabolism
kvq00640  Propanoate metabolism
kvq00650  Butanoate metabolism
kvq00900  Terpenoid backbone biosynthesis
kvq01100  Metabolic pathways
kvq01110  Biosynthesis of secondary metabolites
kvq01120  Microbial metabolism in diverse environments
kvq01130  Biosynthesis of antibiotics
kvq01200  Carbon metabolism
kvq01212  Fatty acid metabolism
kvq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SP68_03875
   00630 Glyoxylate and dicarboxylate metabolism
    SP68_03875
   00640 Propanoate metabolism
    SP68_03875
   00650 Butanoate metabolism
    SP68_03875
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SP68_03875
   00072 Synthesis and degradation of ketone bodies
    SP68_03875
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SP68_03875
   00310 Lysine degradation
    SP68_03875
   00380 Tryptophan metabolism
    SP68_03875
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SP68_03875
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SP68_03875
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SP68_03875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kvq04147]
    SP68_03875
Enzymes [BR:kvq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SP68_03875
Exosome [BR:kvq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SP68_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE88435
Position
complement(2323874..2325055)
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRSLLERGQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPIDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAEIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMILDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
GSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKAHELGLPVLARIVSSAVAGVDPSVMGIGPVSACRK
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgcagtacgcactccggtcggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcagcctgcttgaacgc
ggccagctgcccgccgcggcggtcgacgaactgattttcggccaggtgctcaccgccggc
tgcgggcagaacccggcgcgccagaccgcgctgcgggctggcttgccgatcgacaccccg
gcggtcaccgtcaatctggtgtgcggctccgggctgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgagatcgtcatcgccggcggccaggagagcatgagcaat
gccccctatctgatgcacggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgattctggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaatctggctgatgccttcgacatcagccgtgagcgccaggatgcctttgccgcc
gggtcccagcgcaaagcggcggccgccatcgccgccggacgctttcgcgaggagatcgtc
ccggtcagcgtcccgcagggcaaaaagccgccgcgtgtcgtgactgacgacgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgtcccgctgac
ggcagcgtcactgccggaaacgcctcgtcgctgaacgacggcgccgcggcggtcctgctg
atgcgcgtcgataaagcgcacgagctcgggctaccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccatcggtgatgggcatcggcccggtgagcgcctgccgtaaa
gcgctgcagcgcgccggctggacgctggacgaggtggatcttatcgaagctaacgaggct
tttgccgtccaggcgctggccgtcggtcagctgcttgagtgggatagcgagaaggtcaac
gtcaacggcggcgccatcgcccttggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgactctacaacgttaa

DBGET integrated database retrieval system