KEGG   Klebsiella variicola DSM 15968: SP68_16150Help
Entry
SP68_16150        CDS       T03641                                 

Definition
(GenBank) PTS sorbose transporter subunit IIA
Organism
kvq  Klebsiella variicola DSM 15968
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: AJE90719
UniProt: A0A264BXG7
Position
5205374..5205781
Genome map
AA seq 135 aa AA seqDB search
MVHAIFCAHGQLAGAMLDSVCMVYGEVNVSAVAFVPGENAADIAINLEKLVSAHTDEEWV
IAVDLQCGSPWNAAAGLAMRHPQIRVISGLSLPLALELVDNQHTLSADDLCQHLQAIASQ
CCVVWQQPETVEEEF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgctatcttctgcgcccacggccagctggccggggccatgcttgattcggta
tgcatggtctacggcgaggttaacgtcagcgccgtcgcgtttgtccccggcgaaaacgcg
gcggatatcgccattaacctggaaaagttagtaagcgcccacaccgatgaggagtgggta
atcgcggtagatttgcagtgcggaagcccatggaatgccgcagctgggctggcaatgcgt
cacccgcagatccgggtgattagcggcctgtcgctgccgctggcgctcgagctggtggat
aaccagcataccctgagcgccgatgacttatgccagcatctgcaggccatcgccagtcag
tgctgtgtggtctggcagcagccagaaaccgttgaggaggagttctga

DBGET integrated database retrieval system