KEGG   Klebsiella variicola DSM 15968: SP68_21065Help
Entry
SP68_21065        CDS       T03641                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00052  Galactose metabolism
kvq00500  Starch and sucrose metabolism
kvq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP68_21065
   00500 Starch and sucrose metabolism
    SP68_21065
Enzymes [BR:kvq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SP68_21065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJE91637
Position
4129459..4130859
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVSGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPDGYTGHVRDPKVWQQDGRWYMVLGAQDLQ
QHGKVLLFTASDLREWRLVGEIAGHGVNGLANGGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGTFDHGPLHELDSGFEFYAPQTMLAEDGRRLLVGWMGV
PDGEEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELAALREEAQGWRGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTANRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcagcggactgctgaac
gatcccaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgtgaccatacctataagtgctggggacactggagttcagccgatctgctgcac
tggcggcatgaacctatcgccctgatgccggacgaagagtatgaccgcaacggctgctac
tccggcagcgcggtcgagttcgagggcgccctgaccctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgtaccgcctggcagtgcctggcgacagagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctccctgacggttacaccggccatgtacgcgac
cccaaggtgtggcagcaggacgggcgctggtacatggtcctcggcgcgcaggatttgcaa
cagcacggtaaagtgctgctgttcaccgccagcgatctgcgggagtggcgcctggtgggc
gagatcgccggacatggcgttaacggtctggcgaacggcggctatatgtgggagtgcccg
gatctctttccgctggcggatacccacctgctgatctgctgcccgcaggggctggcccgt
gaagcgcagcgctttctcaatacctatcctgcggtgtggatggcaggccgcttcgacgcc
gagcgcggcaccttcgaccacggcccgctgcacgagctggacagcgggtttgagttctac
gcgccgcagaccatgctggccgaggatggccgccgtctgctggtcggctggatgggcgtc
ccggacggggaagagatgcatcaacccacccgcgcacagggatggatccaccagatgacc
tgcgtgcgcgagctggagtggcaggcgggcaccctgtatcagcgcccgctgcgcgagctg
gctgctctgcgcgaggaagcccagggctggcgcgggcagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagtacgctggggctggactttgccggcgccctg
cagctcaccgccaaccgcgacggcctgcgtctgtcgcgccgcgggctgcagaccgccgag
atgcatcaccgctactggcgcggcgaagcgcggcgcctgcggatctttatcgaccgctcc
agcgtggaaattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagttaatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagtataa

DBGET integrated database retrieval system