KEGG   Ketogulonicigenium vulgare Y25: EIO_0240Help
Entry
EIO_0240          CDS       T01338                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00270  Cysteine and methionine metabolism
kvu00480  Glutathione metabolism
kvu01100  Metabolic pathways
Module
kvu_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EIO_0240 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EIO_0240 (gshB)
Enzymes [BR:kvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     EIO_0240 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD GSP_synth ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADO41425
UniProt: E3EY50
Position
217416..218360
Genome map
AA seq 314 aa AA seqDB search
MALKVAIQMDPIESINIDGDSTFRIALEAQARGHSLFYYTPDKLAFQEGRITARGWPITL
RREKGNHVTKGDEVEVDLADYDVVWLRQDPPFDMGYITTTHLLDMIHPKTLVVNDPFWVR
NYPEKLLVLNFPELTPPTAIARDLDTLRAFRAKHGDVILKPLFGNGGAGVFKLTADDSNL
ASLHEMFTSISREPLIVQKYLPDVRKGDKRVILVDGEPVGAINRVPASGETRSNMHVGGR
PEKVELTARDLEICAKIGPLLREKGQIFVGIDVIGDYLTEINVTSPTGIQELERFDGTNT
AEKIWEAIERRRAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaaagttgccattcagatggacccgatcgaatccatcaatatcgacggcgat
tcgaccttccgcatcgcgctagaggcgcaggcgcgcggccattctctgttctattacacg
cccgacaaactggccttccaagaggggcgcatcaccgcccgcggctggccgatcacgctg
cgccgtgaaaagggcaaccatgtcaccaagggcgacgaggtcgaggtcgatctggccgat
tacgatgtggtatggctgcgccaagacccgccctttgacatgggttatatcaccaccacc
catttgctggacatgatccaccctaagacactggtcgtgaatgacccgttctgggtgcgc
aattaccccgaaaagctgctcgtgctgaatttccccgagctgacccccccgaccgcgatt
gcgcgcgatctggacacgctgcgggccttccgcgccaaacacggcgatgtcattctaaag
ccgctgttcggcaatggcggcgcgggcgtgttcaagctgacggcagatgacagcaacctt
gcatcgctgcacgagatgttcacctcgatctcgcgcgagccgctgatcgtgcagaaatac
ctgcccgatgtgcgcaagggcgacaaacgggtgattctggtcgatggcgagccggtgggc
gcgatcaaccgtgtgccggcctcgggcgagacacggtcgaacatgcatgtgggtggccgc
cctgaaaaggtcgagctgaccgcccgcgatctggagatttgcgctaagatcgggccgctt
ttgcgcgaaaagggccagattttcgtcggtatcgacgtgatcggcgactacctgaccgag
atcaatgtgacctcgcccaccggtatccaggaactcgaacggttcgacggcaccaatacc
gccgagaaaatctgggaagcgatcgagcgtcgccgcgcggcttaa

DBGET integrated database retrieval system