KEGG   Ketogulonicigenium vulgare Y25: EIO_1404Help
Entry
EIO_1404          CDS       T01338                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00010  Glycolysis / Gluconeogenesis
kvu00051  Fructose and mannose metabolism
kvu00562  Inositol phosphate metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
kvu01130  Biosynthesis of antibiotics
kvu01200  Carbon metabolism
kvu01230  Biosynthesis of amino acids
Module
kvu_M00002  Glycolysis, core module involving three-carbon compounds
kvu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIO_1404
   00051 Fructose and mannose metabolism
    EIO_1404
   00562 Inositol phosphate metabolism
    EIO_1404
Enzymes [BR:kvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EIO_1404
Exosome [BR:kvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EIO_1404
  Exosomal proteins of bladder cancer cells
   EIO_1404
  Exosomal proteins of melanoma cells
   EIO_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO42537
UniProt: E3F1K3
Position
complement(1346679..1347377)
Genome map
AA seq 232 aa AA seqDB search
MRRKIAAGNWKMFGTVADLSQIAAIATGADKAVDTLICPPATLIAAAAPHAAASFAIGGQ
DCHPLQSGAYTGEISALMLRDAGATHVIVGHSERRRDHAETNDLVRAKAGAALEAGLTAV
ICVGESLEQREAGITLDAITAELEASLPEGCVGGNTIVAYEPLWAVGTGLIPTPQQIAEV
HGRIRAILRARFGHEAEMIRILYFTAARSKPRTRPRFSRPPMSMARWWAARV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaaaattgctgcgggtaactggaagatgtttggcacggtggcggatctgtcg
cagatcgcagccatcgccacgggcgccgacaaagctgtcgatacgctgatctgcccacct
gccacgctgatcgccgccgccgccccccatgccgcagccagcttcgccatcggcggtcag
gattgccacccgttgcaaagcggcgcctatacgggcgagatttcggccctgatgctgcgc
gacgcgggcgcaacccatgtcatcgtcggccattccgaacgccgccgcgatcatgccgag
accaatgaccttgtccgcgccaaagccggtgccgcattggaagcgggtctgaccgccgtg
atctgcgttggcgaaagcctcgagcagcgcgaagcgggcatcacattggacgccatcacc
gcagaactcgaggcctcgctgcccgagggatgcgtgggcggcaacaccatcgtcgcctat
gagccgctctgggctgtgggtaccggtctgatcccgacccctcagcaaatcgccgaagtg
catggccgcatccgcgctatcttgcgcgcgcgctttgggcacgaggccgagatgatccgc
atcctttactttacggcggctcggtcaaagcctcgaacgcggccgagattttcgcggccg
ccgatgtcgatggcgcgctggtgggcggcgcgagtctga

DBGET integrated database retrieval system