KEGG   Ketogulonicigenium vulgare Y25: EIO_2888
Entry
EIO_2888          CDS       T01338                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EIO_2888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kvu02044]
    EIO_2888
Enzymes [BR:kvu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     EIO_2888
Secretion system [BR:kvu02044]
 Type IV secretion system
  Trb secretion system protein
   EIO_2888
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 TraG-D_C AAA_29 ABC_tran AAA_16 FtsK_SpoIIIE AAA_7 DUF87 DO-GTPase2
Other DBs
NCBI-ProteinID: ADO43958
Position
pYP1:14167..16617
AA seq 816 aa
MMNFTEYRRTSARLSDYLPWAALVGPGIVLNKDGSFQRTAKFRGPDLDSAVAAELVAVAG
RINNAVRRLGSGWSIFVEAQRSEAATYPDSKFPDAASALVDAERKAGFEEAGTHFVSGYF
LTFLWLPPAEDAARAETWLYEGREQSGVNPHELLRGFIDRTDRVLALLDGFMPECRWLDD
GGTLTYLHATISTNRHRVRVPEVPMHLDALLADQPLTGGLEPRLGDQHLRVLTIIGFPTA
TTPGLLDEMNRLAFPYRWSTRAILMDKTDATKLLTKIRRQWFAKRKSIAAILKEVMTNEQ
SALVDTDASNKALDADMALQELGADVAGMAYVTATVTVWDADPRIADEKLRLVEKIIQGR
DFTAMPETVNAVDAWLGSIPGHAYANVRQPPISTLNLAHMIPLSAVWAGPERNEHLGAPP
LLYGKTEGSTPFRLSLHVSDVGHTLVVGPTGAGKSVLLALMALQFRRYERSQIFAFDFGG
SIRASALAMGGDWHDLGGGLTEGSEVSVSLQPLARIDDAYERSWAADWIAAILMREGMTI
SPEVKEHIWTALTSLASAPVGERTITGLAVLLQSNVLKQALRPYCIGGAYGRLLDAEAEH
LGHADVQAFEIEGLVGTGAAPAVLAYLFHRIGDRLDGRPTLLIIDEGWLALDDEGFANQL
REWLKTLRKKNASVIFATQSLSDIDGSNIAPAIIESCPTRLLLPNERAIEPQITAIYRRF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVGLALCAASSKTDQTRIADLVAEH
GQDGFLTAWLRERGVEWAADLIPDLTNLIPPTEKES
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgatgaacttcaccgaatatcgccgcacctccgctcgcctttccgactatctgccatgg
gcagcgctggttggcccaggcattgtgctgaacaaggatggcagcttccagaggaccgcg
aagtttcgcgggccggatctggattctgctgtcgctgccgaactggttgcggtcgccggt
cgcatcaacaacgccgtgcgccgtctgggttctggctggtcgatcttcgtcgaggcacaa
cgctccgaggccgcgacctatcccgacagcaagtttccagatgcggcctccgcactggtc
gatgcggagcgcaaggccgggttcgaggaagcgggcacacatttcgtgtcgggctatttc
ctgaccttcctctggttgccgcccgccgaggacgccgcccgtgccgaaacatggctttac
gaggggcgcgaacaatccggcgtcaatccgcatgaactgctgcgcggcttcatcgaccgc
actgaccgcgtgctggcgctgctcgacggcttcatgcctgaatgccgctggctggatgat
ggtggcacgctgacctatctgcatgctaccatctcgaccaaccgtcatcgtgtgcgcgtg
cccgaagtgcccatgcacctcgatgcgctgctcgccgatcagcccctgaccggcggactg
gagccgcgcctgggcgatcagcatctgcgcgtcctgaccatcatcggtttcccgaccgcg
accacgcctggcctgctcgacgagatgaaccggctcgcgttcccgtatcgctggtcaacc
cgcgccatcctgatggacaagacggacgcgaccaaactgctcaccaaaatccgccgccag
tggtttgccaagcgcaaatccatcgccgcgatcctcaaggaggtgatgaccaacgaacaa
tcggcgctggtggacaccgatgcgtccaacaaggcgctcgatgccgacatggccttgcag
gagctgggcgctgacgtcgccggcatggcctatgtcacagcgaccgtcaccgtctgggac
gccgatccgcgtatcgctgacgaaaagctgcgtctggtcgagaagatcattcagggccgc
gatttcacggccatgccggaaaccgtcaatgccgtcgatgcctggctcggctcgatcccc
ggacatgcctacgccaatgtccggcagccgccaatctcgacgcttaaccttgcccacatg
atcccgctatcggccgtgtgggcggggccggaacggaacgaacacctcggagcgcccccc
ttgctgtatggcaagaccgaaggttcgacgccgttccggctttcccttcatgtcagtgac
gtgggccatactctcgtcgtcggcccgaccggcgcaggcaagtctgtgttgctggcgctg
atggcgctgcaattccgccgctatgaacgcagtcagatcttcgccttcgatttcggggga
tcgatccgggcatccgcgctggccatgggcggcgactggcatgacctcggcggcgggttg
accgagggatcggaggtttccgtctccctgcaaccgctcgcgcggatcgatgatgcctat
gagcggtcatgggccgctgactggatcgctgcaatcctgatgcgcgagggcatgaccatc
tcgccggaggtgaaggagcatatctggacggcgctgacctcgctggcatccgcacctgtc
ggcgagcgcacgatcaccggccttgccgtgctgttgcaatccaatgttctgaaacaggcg
ctgcgcccctattgcatcggtggcgcctatggcaggttgctcgatgccgaggccgaacat
ctcggccacgccgatgtgcaagcctttgaaatcgagggactggtgggcacgggcgctgcg
ccggccgtgctggcctatctgtttcatcggatcggcgacaggctcgacggtcgcccaacc
ctcctcatcatcgacgagggctggctggcgctggatgacgaggggttcgccaaccagctg
cgcgaatggctgaagacgctcagaaagaagaacgcttccgtcatcttcgcaacgcagtcg
ctctcggacattgacggcagcaatatcgcgcccgccatcatagaaagctgcccgacacgg
ctgctcctgccgaacgaacgggccatcgagccgcagatcactgcgatctatcggcggttc
gggctgaatgaccggcagatcgagatcctcgcgcgggcaacgcccaagcgggactattac
tgccagtcgcgccgcggcaatcgcctgttcgagctgggcctgtccgaagtcggcctcgcg
ctctgcgccgcatcatccaaaaccgatcagacccgcatcgccgatcttgtcgccgaacat
gggcaggacggtttcctcaccgcctggctgcgcgagcgcggcgtcgaatgggcggccgac
ctgatccccgatctcaccaatctcatccccccgaccgaaaaggagtcctga

DBGET integrated database retrieval system