KEGG   Kyrpidia spormannii: CVV65_03605Help
Entry
CVV65_03605       CDS       T05215                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
kyr  Kyrpidia spormannii
Pathway
kyr00860  Porphyrin and chlorophyll metabolism
kyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kyr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CVV65_03605
Enzymes [BR:kyr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CVV65_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ATY84149
UniProt: A0A2K8N3Z0
Position
729813..731420
Genome map
AA seq 535 aa AA seqDB search
MPRPEAAVSPPARCIMLQGTASNVGKSWLATGFCRVLAQDGWRVAPFKSQNMALNSYVTM
DGGEIGRAQGVQAEAAGVIATVDMNPILLKPCGPASAQVILRGKPLTDAGAREYRERLIP
ELLGAVKESLDRLRQEAEVVVIEGAGSPAEINLKDRDIANMRIAALADAPVLLVGDIDRG
GVFASFVGTLELLNPEERRRVKGFLINKFRGDPSLLEPGLKWLEARTGVPVIGVVPWEDL
PIDGEDSLALPGGFGEGPLEIVAIRLPHLSNYTDLDPLRLEPDVRIRWVERPEALGDPDA
VILPGTKNSIGDLVWLRDRGLAAAIGDFAARGGRVVGLCGGYQMLGIRLTDPEGIEGGRP
GEEVPGLGLLPAETAFFPTKRVLRRAGRVAAEELGPDLQGVPVEGYEIHMGRTSWCEEPR
SLLWLESAGGEAGYPEGAVSRDGKVWGTYVHGIFDSWAFRRRWLDGLRREKGLPPLEGQV
RDMYAVREEAFDRLAALLRQHVDWERVYRFLALEPPGAPRRRGRDPRAVPGEPGA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggcctgaggcggcggtctctcccccggccaggtgcatcatgttacagggcacg
gcctctaacgttgggaaaagctggctggccaccggcttttgccgagttctggcccaggac
ggctggcgggtggcgccctttaagtcgcaaaatatggcgttaaacagctatgtcacgatg
gacggcggggagattggccgggcccagggggttcaggccgaggccgccggcgtgatcgcc
accgtcgacatgaacccgattttgctcaagccgtgcggccccgcctcggcccaggtgatc
ctccgagggaaacccttgacggacgccggcgcccgggaataccgggaacgcctgattccc
gaacttctaggtgcggtgaaagaatccctggaccggctccgtcaagaggcggaagtggtg
gtgatcgaaggggcgggcagtccggcggaaatcaatttgaaagaccgggacatcgcgaat
atgcgcatcgccgccctggccgacgccccggttctcctggtgggagacatcgaccggggc
ggggtgtttgcttccttcgtggggaccctggagctgctcaacccggaggagaggcggcgg
gtgaagggctttttgatcaacaaattccggggcgacccgtcgttgctcgaaccggggctg
aagtggctggaggcgcggaccggggtgccggtgatcggggtggttccctgggaggatttg
cctatcgatggcgaggattccctggcccttcccggcggcttcggggaggggccattggag
attgtcgccatccgtttgcctcacctgtcgaactatacggacctcgatcccctgcgactg
gaacccgacgtgcggattcgctgggtggagcggccggaggcgttgggggatccggacgcc
gtgatcctgcccggcacgaaaaatagcatcggggacttggtctggctccgggatcggggg
ctggcggcggccatcggcgattttgccgcccgggggggccgggtggtggggctgtgcgga
ggttatcaaatgctgggtattcgcttgacggacccggaggggatcgaaggggggcgcccg
ggggaggaggtgcctgggctcggcctccttcccgcggagacggcgtttttcccgaccaag
cgtgtcttgcgcagggccggccgggtggcggcggaggagttggggccggatttgcaaggt
gtgccggtggaggggtacgagattcacatgggccggacgtcctggtgcgaagagccccgc
tctttattgtggcttgagtctgccgggggggaggcggggtatcccgagggcgccgtgtcc
cgggatggaaaggtctgggggacgtatgtccacgggattttcgacagctgggccttccgg
cgccgctggctggatgggctgcgccgggagaagggtctgccccctcttgaaggccaggtg
cgggacatgtatgctgtccgggaggaagctttcgatcggttggcggctttgttgcgacaa
catgtcgactgggagcgggtttatcgtttcttggctctggagcctccgggcgcgccccgg
cgcaggggaagggatccgcgggcggtgcccggggaacccggggcgtga

DBGET integrated database retrieval system