KEGG   Kyrpidia spormannii: CVV65_08995Help
Entry
CVV65_08995       CDS       T05215                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
kyr  Kyrpidia spormannii
Pathway
kyr00471  D-Glutamine and D-glutamate metabolism
kyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kyr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CVV65_08995 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kyr01011]
    CVV65_08995 (murI)
Enzymes [BR:kyr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CVV65_08995 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:kyr01011]
 Precursor biosynthesis
  Racemase
   CVV65_08995 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATY85042
UniProt: A0A2K8N9D7
Position
1763757..1764632
Genome map
AA seq 291 aa AA seqDB search
MKEAWALRIGMYDSGVGGLTVLAAFVRHMPEHDYVYFGDTLHAPYGDRTAEEVRALSLAA
VKQLVARDIDLLVVACNTSASVAVDTLVDHYPDLPVLTLLDAVGPAVQHFPGRKIALLAT
RRTVEAGVFEARLRSARPDAAVRSVAAPALVPLIERGVKDPAVYGPFLDSYLKPLATWGA
EVLVLGCTHYPLIANQIQSRVPHTLLIDPANHLARHVAEKQDAFPASSSSGSVTLLASGD
ATVLDAFWKSVSSQIQTEASEEYGHIGLRRKPTTSGAKAVTHGSATPGMHP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggcctgggcgttgaggatcggtatgtacgactccggggtgggcggactgacc
gtcttggcagcgttcgtacgtcacatgcccgaacatgattatgtctactttggcgatacc
cttcatgccccctatggcgatcgaaccgcagaagaggtacgcgccctttccttggccgca
gtgaaacaactggtggcccgggacattgacctcttggtcgtggcctgcaataccagcgca
tccgtggccgtggacaccctcgtggatcattatccggatttgcctgtactgaccctactg
gatgcggtcggcccggcggtccaacatttccccgggagaaaaatcgcccttctcgccacg
cggcgcaccgtagaagcgggggtttttgaagcccgacttcgatccgcacgacccgacgca
gcggtgaggagcgtggccgcccccgccttggtaccgctgatcgaacgaggcgtgaaagat
cctgcggtttatgggccttttttagacagctatctaaaaccgctggccacttggggcgcc
gaggttttggtgctcgggtgcacccattatccgctgatcgccaatcagattcagagccgg
gtgccccacaccctcctcattgatcccgcgaatcacctcgcacggcatgtcgctgaaaaa
caagacgcttttcccgcgtcgtcctcatcaggatcggtcacgctgctggccagtggggat
gccactgttcttgacgcattctggaaatccgtctcttcccagatccagactgaagcctcg
gaggaatatggccacatcgggctgcgcagaaagccaaccacctcgggagccaaagcggtc
actcacggttctgcgacaccaggcatgcacccttga

DBGET integrated database retrieval system