KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_01430Help
Entry
WSI_01430         CDS       T02506                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
laa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:laa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WSI_01430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:laa01007]
    WSI_01430
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:laa03016]
    WSI_01430
   03029 Mitochondrial biogenesis [BR:laa03029]
    WSI_01430
Enzymes [BR:laa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     WSI_01430
Amino acid related enzymes [BR:laa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   WSI_01430
Transfer RNA biogenesis [BR:laa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WSI_01430
 Prokaryotic type
   Other AARSs
    WSI_01430
Mitochondrial biogenesis [BR:laa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WSI_01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AGH16656
Position
complement(307996..309801)
Genome map
AA seq 601 aa AA seqDB search
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFE
IAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREY
PESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDF
LVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDME
MSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMH
NVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIF
WRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHI
AQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAF
QYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIA
AGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKNIK
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgttatcgcactcattcttgtggagatctcggagtttctgatgttggttccttt
gtgcgtctatcaggatgggtacatcgtgtacgtcctcatggaggtattattttcctagat
attcgcgatcactacggtatcacgcaagtagtcgctaatcctgattctgcttgttttgag
attgctaaatctgtacgtagtgagtgggttttgtgtattgatggattggttatgtccaga
agtgcagaaaccatcaatgctaatattataactggtcagattgaattgtctgcgcagaaa
atagaaattctttctgtggcagaggagcttcctctgccagtttttggagagagagaatac
cccgaaagtattcgtttcaaataccgttttcttgatttacgtcgagatactttgcataag
aatattgtgaagcgaactcgtattatcaattctatgcggtgtcgcatgattgcggagaat
tttattgaatgttctactccaattttgaccgcttcttctccagagggggcgagggatttt
cttgtcccaagcagagtaaatcaaggttctttttatgcacttcctcaagcgccacaacag
tataagcagttgttgatggcatccggatttgatcgttattttcaaatagccccttgtttt
cgagatgaagatcctaggtctgatagacttccgggggaattttatcaacttgatatggaa
atgagttttgtagaacaagatgatatcttgaatactatggaaaatgttttgcgtggagtt
tttgaagaattctctaatggaaatactgtgagtaataattttctaagaatttgttatgat
gatgctattcgtagatatggtacagataaacctgatttgcgtaatcctataattatgcat
aacgtgacagagcattttgtacattctgaatttcgggtgttttctaagatcttatccgtt
aatccaggatatgaagtttgggcaattccagctaaggggggaggtggaaatcgtgccttt
tgtgatcggatgaatgagtgggcacgatcacaagggcagcctgggcttgcttatattttt
tggcgtttagatgaaagtggtaatgtggcggggatgggtcctgttgcaaagcatttgaat
attgtcaatacagaggctatacgtgtgcgtcttgatatgcaagatggggattcatgtttc
tttatcgcgggggatcctctaaaattttgttcatttgctgctgatgctcgaaatcacatt
gcacaagagctgggaataattaattgtaattgctttgaattctgttggattatggatttt
cctttctatgagtggaatgaggaagagaaaaaaatagactttgctcataatccatttacg
atgccacagggagggatggaatctctgaagggaaatgatctgttgtctattaaagcattt
caatatgatttagtgtgcaatggttttgaaattgcttcaggggggattcgcaatcatatg
tctgaagtgatgcttcaagcattttctaatgtgggaatcagcaaagaggttgttgaaaat
cgttttggagggttatatcgtgcatttcaatgtgggatgcctccacatggaggtatagca
gcaggcattgaccggatagtgatgcttcttttgggtgcaaagaatgtgcgagaggtttcc
ttattcccgatgagtcagaatttttgtgatcttcttatggggtcaccatctactgtaagt
gttgagcaactgcgtgaattaggattacgaatagtagaaaatcctaaaaaaaatattaaa
aattag

DBGET integrated database retrieval system