KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_02895Help
Entry
WSI_02895         CDS       T02506                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
laa00230  Purine metabolism
laa00250  Alanine, aspartate and glutamate metabolism
laa01100  Metabolic pathways
Module
laa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:laa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WSI_02895
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WSI_02895
Enzymes [BR:laa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     WSI_02895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGH16949
Position
646048..647346
Genome map
AA seq 432 aa AA seqDB search
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV
RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG
ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE
KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV
TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG
TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP
DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER
ENTLIMSNPFED
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgtagtggtagttggcttacaatggggtgatgaagggaaaggaaagattgta
gattggctttcagaaaatgctgacgttattgtaaggtttcagggagggaataatgctggc
catactttaaaagttaatgatatcgtttataagttatctctccttccatcaggggtagtg
cgtcctgataagatgtccattataggaagtagtgtggtagtagatccacatgcttttata
tctgaaattgaaagtttagcgcatcagggaatttgtgtaacccctaataatttgcgtatt
gctaataatgcatcgctaatattatcgattcatagggatcttgatatgttgcgagaaggt
gcgctttccccatgcggtgcccatattgggacaacacaaagaggtattggcccagcctat
gaagatagagtcggacgacgtgccattcgtgtgatggatctcactgatgtggagcatatt
tcaaaaaaaattgaacagttattattgcatcataatgcgttgagacgttcttttggggaa
aaagaggttttatataagacgatattggaagaattgatgtatgcacgagaaaaaattctc
ccttttatggatgttatatggtctctgcttgaacgtgaatctcgcaaaggggcacatatt
ctctttgaaggggcacaaggttttctgttggataatgatcatggaacctatccttttgta
acatcttctaatacaatgtctgcacaagcatctattgggtctgggatttctcccggttct
ttgggatatgtgcttggggtagttaaagcttacacgacacgtgttggtggagggcctttt
cccactgaattaaagaatcaaactggtgattttttaaaagaagttggaaaagaatttggt
acagtgactaatcgacaacgtcgctgtggttggttggatttagcatcagtacgtcgttct
gtcattatcaatggcgttaaaggaatagctttaacaaaacttgacgttcttgatggtctt
gatgaattgaaaatttgtgtgggatatcgaatggatggtcgtgaagtagattttttgccg
gatgactctatatatcatactcgttttgaacctgtatatatgatattagagggatggaag
cagtctactgctggtatgcgtgtcttcgctgatcttcctatacaagcgaggaattacata
cgaaaaatagaagaggtattggaagtgccagttgctttattatccattggcccagagagg
gaaaataccctaattatgtctaacccattcgaagattaa

DBGET integrated database retrieval system