KEGG   Lysobacter antibioticus 76: LA76x_0054Help
Entry
LA76x_0054        CDS       T04154                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00360  Phenylalanine metabolism
lab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lab00790  Folate biosynthesis
lab01100  Metabolic pathways
lab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LA76x_0054 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LA76x_0054 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LA76x_0054 (phhA)
Enzymes [BR:lab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     LA76x_0054 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ALN78216
UniProt: A0A0S2F3V4
Position
complement(56395..57213)
Genome map
AA seq 272 aa AA seqDB search
MIEQPWASYSGQDHAVWAQLFERQQQVLVGRASDEFLTAQRAMHMSPQQIPKFEDLNRVL
RAHTGWELIGVEGLLPELTFFDHLANRRFPVTWWIRKPEQIDYLAEPDLFHDLFGHVPLL
MNPVFADYMEAYGRGGVKAHGINPEALVHLTRLYWYTVEFGLIKQADGLRIYGSGIVSSK
SESIHCLESAAPNRIGFDLERIMRTRYRIDTYQKTYFVIDSFEQLMRATEPDFTPIYDRL
ATQDSIPAGDVLATDTVFHRGSGEGWLTDGDV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagcagccgtgggcgtcgtattcgggccaggaccatgcggtgtgggcgcagttg
ttcgagcgccagcagcaggtgctggtcggccgggccagcgacgagttcctgaccgcgcag
cgggccatgcacatgagcccgcagcagatcccgaagttcgaggacctcaaccgcgtgctg
cgtgcgcacaccggctgggagctgatcggcgtcgagggcctgctgccggaactgaccttc
ttcgaccacctcgccaaccgtcgtttcccggtgacctggtggatccgcaagcccgagcag
atcgattacctggccgagccggacctgttccacgacctgttcggccacgtgccgctgctg
atgaacccggtgttcgccgactacatggaggcctacggccgcggtggcgtcaaagcgcac
ggcatcaaccccgaggcgctggtccacctgacccggctgtactggtacacggtcgaattc
ggcctgatcaagcaggccgacggcctgcgcatctacggcagcggcatcgtctcgtcgaag
agcgaatcgatccattgcctggagtcggccgcgcccaaccggatcggcttcgatctggag
cggatcatgcgcactcgctaccgcatcgacacctaccagaagacctacttcgtcatcgac
agcttcgagcagttgatgcgggcgaccgaaccggacttcaccccgatctacgaccgcctc
gccacccaggattcgatcccggccggcgacgtgctcgccaccgacacggtgttccatcgc
ggcagcggcgagggttggctgaccgacggcgacgtctga

DBGET integrated database retrieval system