KEGG   Lysobacter antibioticus 76: LA76x_0197Help
Entry
LA76x_0197        CDS       T04154                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00330  Arginine and proline metabolism
lab00360  Phenylalanine metabolism
lab00380  Tryptophan metabolism
lab00627  Aminobenzoate degradation
lab00643  Styrene degradation
lab01100  Metabolic pathways
lab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LA76x_0197
   00360 Phenylalanine metabolism
    LA76x_0197
   00380 Tryptophan metabolism
    LA76x_0197
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LA76x_0197
   00643 Styrene degradation
    LA76x_0197
Enzymes [BR:lab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     LA76x_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALN78359
UniProt: A0A0S2F495
Position
complement(221179..222732)
Genome map
AA seq 517 aa AA seqDB search
MNPISRPDLPGAPGGTSASSCGPSITSTHNGLASAELAFSSATDLALLIQRKQVSSFELT
QYYIERIEQFDKLLNAVVVRDFERALEAAKSADASLARGHRLGSLHGVPMTIKEAFDVSG
LPTTWGVPEQRDNLAQNDATVVEHLKAAGAHFMGKTNVALRLADWQSYNDIYGTTNNPWN
RERSPGGSSGGSAAALAAGLTGLEFASDIAGSIRNPSHFCGVYGHKPTYGIVPTLGHNPL
GVASAPDLNVVGPMGRSAEDLELALDVVAGPDRFRSPGWRLVLPPPKARTLRGLRVAIWP
KEEFVPTSVEISDRVQQVGEVLARAGAVVCDRARPEISPRQSHSTYLNLLASTGLVNLPD
EYYSVAQAAAAQFDANDDSPLAVVTRARVLDHRSWSDHDEARTNYRLRWRAFFDDWDVVI
CPISATTAYRHDHRPKLERVLAVDTVPTSHYEHYFWIGLATLAYLPSTAFPCGLSNDGLP
IGLQIIGPEYSDRTTIEAARLIAQELGGFQAPPGFGV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgatttccaggcctgaccttcctggggcgccaggcggcacttcagcttcatcc
tgcggcccttccattacatctacgcacaatggcctcgcatcggcagagctggctttttcg
tcagcgaccgacctggcactgctgatccagcgaaaacaagtcagctcgttcgaactcacc
cagtactacatcgaacgcatcgagcagttcgataaactgttgaatgctgtcgtggtgcgg
gatttcgaacgcgcactggaagcggcgaagtcggccgatgcgtctcttgctcgcggacac
cgattgggatcgctgcacggcgtcccgatgacgatcaaggaagccttcgatgtttctgga
ttgcccactacgtggggcgtgccggagcaacgcgacaacctcgcccagaacgacgcaacg
gttgtcgaacacctgaaggcagccggcgcccatttcatggggaaaacgaacgtcgcgctg
cgactcgcggactggcagagctacaacgacatttacggaacgaccaacaacccctggaat
agggagaggtcgccgggcggatcttccggcgggtcggccgctgcgctagcggccggtttg
accggcctggaatttgcctccgatatcgccgggtcgatccgaaatccgtctcacttctgt
ggcgtatatggacacaaacccacttatggcatcgttccgacgcttggccacaatcctctc
ggcgtcgcatctgcgccggatctgaatgtcgtcgggccaatggggcgaagtgcggaagat
ttggagctggctctggatgtcgtagcgggccctgaccggttccggtcaccgggctggcga
ctggtgcttccaccaccgaaggcgcgcactttacgcggcttgcgcgttgcgatttggccc
aaggaagagttcgttcctacctctgtcgagatatcggatcgcgtgcagcaagtcggagaa
gttctggctcgggcgggcgcggtagtctgcgatcgggcgcgccctgaaatctctccacgg
caatcgcacagcacctatttgaacctgctggcgtcgacaggactggtcaaccttcccgat
gaatactattccgttgcccaagcggcggccgcacagttcgatgcgaacgatgattcgccg
ttagcggtagttacgcgtgcccgcgtactggatcatcgaagctggtccgatcacgatgaa
gcgcgtaccaactaccgactgcgctggcgcgccttcttcgacgattgggatgtggtgatc
tgcccgatttccgcaaccacggcctaccgacacgatcatcggcccaagctggaaagagtt
ctcgcggtcgacacggtaccgacttcgcattacgagcattacttctggataggccttgcg
accctcgcctatttgccgagcactgcttttccctgcggattgtcgaacgatgggctgccg
atcggcctgcagatcatcggcccggaatatagcgaccggaccaccattgaggcagcccga
ctgatcgcacaagagctgggcggttttcaggcgccgcctggtttcggggtttaa

DBGET integrated database retrieval system