KEGG   Lysobacter antibioticus 76: LA76x_1063Help
Entry
LA76x_1063        CDS       T04154                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00350  Tyrosine metabolism
lab00643  Styrene degradation
lab01100  Metabolic pathways
lab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LA76x_1063 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    LA76x_1063 (maiA)
Enzymes [BR:lab01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     LA76x_1063 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ALN79222
UniProt: A0A0S2DWZ0
Position
1228320..1228982
Genome map
AA seq 220 aa AA seqDB search
MSEQLRLYSYWRSSASYRVRIGLNLKGLDYEIVPVHLVRDGGEQHAAAYRELNPQGLVPV
LQHGQRTLTQSIAILEYLDETWPRPNLLPTTARERHRVRAIAQTIACEIHPLNNLRVLKY
LDGTWNVPQPERDGWVKHWISEGFTALETMLAEDPATGVFCVGDLPGLADCCLVPQLYNA
RRFGVPLEAYPTLLRIEAACLALPEFDAARPENQPDCPPA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacaattacggttgtattcgtactggcgttccagcgcctcgtatcgggtgcgc
atcggcctgaacctcaagggcctggactacgagatcgtgccggtccacctggtccgcgac
ggcggcgaacagcacgccgccgcctatcgcgaactcaatccgcaggggctggtgccggta
ttgcagcacggccagcgcaccctgacccagtcgatcgcgatcctggaatacctcgacgag
acctggccgcgtccgaacctgctgccgacgaccgcgcgcgagcgccatcgggtacgcgcg
atcgcccagaccatcgcctgcgaaatccacccgctcaataatctgcgcgtgctgaagtac
ctcgacggcacctggaacgtgccgcagcccgagcgcgacggctgggtcaaacactggatt
tccgagggcttcaccgcgttggaaacgatgctcgccgaggacccggccaccggcgttttc
tgtgtcggcgacctgcccgggctggccgattgctgcctggtgccgcagctctacaacgcg
cgccgtttcggcgtaccgctggaagcctacccgaccctgttgcggatcgaagccgcctgc
ctggccctgccggaattcgacgccgcgcgcccggagaaccagccggactgcccgccggcc
tga

DBGET integrated database retrieval system