KEGG   Lysobacter antibioticus 76: LA76x_3181Help
Entry
LA76x_3181        CDS       T04154                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00071  Fatty acid degradation
lab00072  Synthesis and degradation of ketone bodies
lab00280  Valine, leucine and isoleucine degradation
lab00310  Lysine degradation
lab00362  Benzoate degradation
lab00380  Tryptophan metabolism
lab00620  Pyruvate metabolism
lab00630  Glyoxylate and dicarboxylate metabolism
lab00640  Propanoate metabolism
lab00650  Butanoate metabolism
lab00900  Terpenoid backbone biosynthesis
lab01100  Metabolic pathways
lab01110  Biosynthesis of secondary metabolites
lab01120  Microbial metabolism in diverse environments
lab01130  Biosynthesis of antibiotics
lab01200  Carbon metabolism
lab01212  Fatty acid metabolism
lab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA76x_3181
   00630 Glyoxylate and dicarboxylate metabolism
    LA76x_3181
   00640 Propanoate metabolism
    LA76x_3181
   00650 Butanoate metabolism
    LA76x_3181
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA76x_3181
   00072 Synthesis and degradation of ketone bodies
    LA76x_3181
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA76x_3181
   00310 Lysine degradation
    LA76x_3181
   00380 Tryptophan metabolism
    LA76x_3181
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA76x_3181
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA76x_3181
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA76x_3181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lab04147]
    LA76x_3181
Enzymes [BR:lab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA76x_3181
Exosome [BR:lab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA76x_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALN81309
UniProt: A0A0S2DQ62
Position
3675223..3676398
Genome map
AA seq 391 aa AA seqDB search
MSDVVIVGAKRTAIGSFLGQFTGVPTPTLGSAAITGALEQAGVAADQVDEVIMGCVLPAG
LGQAPARQAALNAGLPTSAGCTTINKVCGSGMKAIMLAHDLIKAGSAKVVVAGGMESMTN
APHLLNNSRTGIRYGSTEMLDHMAWDGLTNPYDGKAMGVFGDAACEKYGLDRAAIDAYSE
ESVKRAQAAQSAGHFKDEIVPVTVKGRKGDVVVDSDEEPAKIDVSKIPGLRPAFGKDGVL
TAASSSKISDGAAAALLMSADDAAARGLKPLARIVAHAGHAQAPEWFTTAPVKAISNVLE
KAGWTVADVDLFEVNEAFSCVAMAPMKDLGIPHDKINVHGGAVALGHPIGASGARLVVTL
INALRLRGGKRGVASLCIGGGEATAIAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcgtcatcgtcggtgccaagcgcaccgccatcggttctttcctcggccag
ttcaccggcgtcccgaccccgaccctgggcagcgccgcgatcaccggcgcgctcgagcag
gccggcgtcgccgccgatcaggtcgacgaagtcatcatgggctgcgtgctcccggccggc
ctcggccaggccccggcgcgccaggcggcactcaacgccggcctgccgacctcggccggc
tgcaccacgatcaacaaggtctgcggctcgggcatgaaggcgatcatgctcgcccacgac
ctgatcaaggccggctcggccaaggtcgtcgtcgccggcggcatggagtcgatgaccaat
gcaccgcacctgctcaacaactcgcgcaccggcatccgctacggcagcaccgagatgctc
gaccacatggcctgggacggtctgaccaacccgtacgacggcaaggccatgggcgtgttc
ggcgacgcggcttgcgagaaatacggcctggatcgcgctgcgatcgacgcgtattccgag
gaaagcgtgaagcgcgcgcaggctgcgcagagcgccggccacttcaaggacgagatcgtt
ccggtgaccgtcaagggccgcaagggcgatgtcgtcgtcgacagcgacgaagagccggcc
aagatcgacgtcagcaagatccccggcctgcgcccggcgttcggcaaggacggcgtgctg
actgccgcgtcctcctcgaagatctccgacggcgccgccgccgcgctgctgatgtcggcc
gacgacgccgccgcgcgcggcctcaagccgctggcccggatcgtcgcccatgccggccac
gcccaggcgccggaatggttcaccacggcaccggtgaaagcgatttcaaacgtgctcgaa
aaggccggctggacggtcgccgacgtcgacctgttcgaggtcaacgaggccttttcctgc
gtcgcgatggcgccgatgaaggacctcggcatcccccacgacaagatcaacgtccatggc
ggcgcggtcgccctgggacacccgatcggcgccagcggcgcccgcctggtggtcacgctg
atcaatgccttgcgcctgcgcggcggcaagcgcggcgtcgcttcgctgtgcatcggcggc
ggcgaagcgaccgcaattgcgatagagttgctctaa

DBGET integrated database retrieval system