KEGG   Lysobacter antibioticus 76: LA76x_3923Help
Entry
LA76x_3923        CDS       T04154                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lab  Lysobacter antibioticus 76
Pathway
lab03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lab00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LA76x_3923 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lab03011]
    LA76x_3923 (rplV)
Ribosome [BR:lab03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LA76x_3923 (rplV)
  Bacteria
    LA76x_3923 (rplV)
  Archaea
    LA76x_3923 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALN82045
UniProt: A0A0S2E0P2
Position
complement(4496069..4496404)
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAALIRKVVESAIANAEN
NQGADVDELKVTTIMVDEGPALKRFMARAKGRGTRILKRTSHITVVVGAGK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagccatcctgcgcaccgcgcgcatctccccgcagaaggcccgcctggtc
gccgaccaggtgcgcggtctgtccgctgagcgcgccgtcaacctgctgaagttctcggac
aagaaggcagctgcactgatccgcaaggtcgtggagtccgccatcgcgaacgccgagaac
aaccagggcgccgacgttgacgaactcaaggtcacgaccatcatggtggacgagggtccc
gcactgaagcgcttcatggctcgtgcgaaaggccgcggcacccgcatcctcaagcgcacc
agccacatcactgtggttgtgggcgcgggcaagtaa

DBGET integrated database retrieval system