KEGG   Labrenzia sp. PHM005: FJ695_04285Help
Entry
FJ695_04285       CDS       T06152                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
labp  Labrenzia sp. PHM005
Pathway
labp00480  Glutathione metabolism
labp00590  Arachidonic acid metabolism
labp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:labp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FJ695_04285
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FJ695_04285
Enzymes [BR:labp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FJ695_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QDG75143
UniProt: A0A4Y6RQA7
Position
complement(988312..988902)
Genome map
AA seq 196 aa AA seqDB search
MPRFAPAAAVLTGFLALTGNTIAADTASQSGSAHEYSFELANGLSLPMKEFEGKLVLVVN
TATACGFSGQLSGLQELHERYSDRGLVVLGVPSNDFGGQEPRKDGDIAAYCEAKYGATFQ
MTAKTSVRGKAAHPFYQWAVRELGFLARPNWNFHKYLIGPDGALVSWFATPAKPTSKAVI
TEIEKHLDQLTADQST
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccccggttcgcccccgccgccgcagttcttaccggctttcttgccctaacaggcaat
accattgccgccgatacggcatctcagagcggcagtgcccatgagtatagttttgagctc
gcaaacggtttatccctgccaatgaaggagtttgaaggcaagcttgtgctggtcgtcaat
acagcgacggcttgcggcttcagcggccagctctctggactgcaggaacttcacgaaaga
tattccgaccgcggactggtggtgctgggcgtcccgtccaatgatttcggtggccaggaa
ccgcggaaagacggcgacatcgccgcctattgcgaagccaaatacggtgcaaccttccag
atgaccgcaaagacatctgtacgcggcaaggctgcccatccgttttatcaatgggccgtc
cgcgaacttgggtttcttgcccgcccaaattggaattttcataaatatctaatcggaccc
gacggcgctttggtctcctggttcgcaactccggccaagccgacgtccaaggcggtgatc
accgagatcgaaaaacatttggaccagctgactgctgatcagagtacgtag

DBGET integrated database retrieval system