KEGG   Labrenzia sp. PHM005: FJ695_05460Help
Entry
FJ695_05460       CDS       T06152                                 

Definition
(GenBank) Gfo/Idh/MocA family oxidoreductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
labp  Labrenzia sp. PHM005
Brite
KEGG Orthology (KO) [BR:labp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FJ695_05460
Enzymes [BR:labp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     FJ695_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C Semialdhyde_dh ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: QDG75357
UniProt: A0A4Y6RSL4
Position
1217554..1218555
Genome map
AA seq 333 aa AA seqDB search
MRWGLIGASRIASSYVIDAIRAQAGSEIQSVLSSDEARGQAYAQDHQIPDSYTDLDALLA
DDSVDAVYISTTNEKHHPQAMAAIAAGKHVLCEKPLAMTLGEAVEMVRAAADKDVTFATN
HHLRNAGSHLAIRDLIASGRIGKVLSARVFHAVNLPEHLRGWRINDASAGGGVIPDITVH
DADTVRFHLAEDPVDVVAKAGVSGMGEGVEDSVMSVWSMPSGVMVQSHESFTHGYAGTGV
EFHGTEGSIFARNVMTQEPVGEIRLVDASGESQVPYETHNLYHRAIGLFAGAAAGKGAPS
ADGVDGVKSLAVALAVREAARSGQATHVDYGGL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggggactgataggcgcgagccggattgcgtccagttatgtcattgacgccatc
cgggcgcaggcgggatcggaaatccaatccgttctgagctccgatgaggcgcgtggccaa
gcctacgcgcaggatcaccagatcccggacagctatactgatctggatgccctgctcgcc
gatgacagcgtcgacgcggtttacatctcgaccacaaatgaaaaacaccacccgcaggcc
atggcagcgattgccgccggtaaacatgtcctgtgcgaaaaaccgctcgcgatgacctta
ggcgaagctgttgagatggtgagggctgcggcggacaaagacgtgacctttgcgaccaat
caccatcttcgcaatgccggttcccaccttgccattcgcgatctgattgcctcaggccgg
atcggcaaggttttgagcgcccgggtgtttcatgcagtcaatctgccggagcacctacgc
ggttggcggatcaatgatgcctctgctggcggtggcgttattccggatatcacggttcac
gatgctgatactgttcggtttcatctggctgaagacccggtcgatgtggttgccaaggct
ggcgtatccggcatgggtgagggtgttgaagacagtgtcatgtcggtctggtccatgcca
tctggcgtgatggttcagtcccacgagagttttacccatggatacgccggtaccggggtc
gaattccacggaaccgaagggtcgatctttgcacgcaatgtcatgacccaggagcctgtc
ggcgagattcggctggtcgatgcgtcaggagaaagccaagtcccttacgagacgcacaat
ctctatcaccgcgcgataggcctttttgccggagctgctgcgggcaaaggtgcaccgtca
gcggatggtgttgatggcgtgaagtctttggcggttgcgctcgccgtacgcgaggcggcc
cgttcgggccaggcaacgcacgtcgactatggagggctttga

DBGET integrated database retrieval system