KEGG   Labrenzia sp. PHM005: FJ695_14285Help
Entry
FJ695_14285       CDS       T06152                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
labp  Labrenzia sp. PHM005
Pathway
labp00361  Chlorocyclohexane and chlorobenzene degradation
labp00625  Chloroalkane and chloroalkene degradation
labp01100  Metabolic pathways
labp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:labp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FJ695_14285
   00361 Chlorocyclohexane and chlorobenzene degradation
    FJ695_14285
Enzymes [BR:labp01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     FJ695_14285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD VHL Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: QDG76950
UniProt: A0A4Y6RXH2
Position
complement(3181662..3182324)
Genome map
AA seq 220 aa AA seqDB search
MAYAAYVFDAYGTLFDVHAAVRKHAAKLGPDAQRLSSLWREKQLEYSWVRALMGQYKDFW
ELTQQGLDTAFELVPSADKSLKDDLLNAYWTLDCYPEVPQVLTDLKATGAKIAILSNGSP
DMLEAAAKASGLTDLFDEIFSVDSLRTFKTDPQTYEMVTTHFRIYPEEVSFQSSNRWDVA
GATAFGFRTVWMNRTGQPDEYKDLSPKAVLADLTGLSALV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatgccgcttatgtcttcgatgcttacggtaccttgtttgatgttcacgccgcc
gtgcgcaagcatgccgccaaacttggtcctgatgcacagcggttgtcatcgctttggcgc
gagaaacaactggaatattcctgggtccgggccttgatgggtcaatacaaggacttttgg
gaactgacacaacaaggtctggatacggctttcgaacttgtgccgtcagccgacaagtca
ttaaaagacgacttgttgaatgcctattggacgctggattgttatccggaagtcccccag
gtactgaccgatctgaaagccacgggtgccaagattgcaattctctccaacggttctccg
gacatgctggaggcggctgccaaagcgtcaggcctgacggatctcttcgacgagatcttc
tcggttgatagcctcaggacttttaagaccgatccgcaaacctatgaaatggtgaccaca
cacttccggatctacccggaagaagtctcgtttcaatcgtccaaccgctgggacgttgcc
ggcgcaaccgctttcgggttccggaccgtttggatgaacaggaccgggcagccggatgag
tataaggacctgtctcccaaagcggtacttgcggatctgactggcctgtctgcgttggtt
tag

DBGET integrated database retrieval system