KEGG   Labrenzia sp. PHM005: FJ695_27330Help
Entry
FJ695_27330       CDS       T06152                                 

Definition
(GenBank) thiolase domain-containing protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
labp  Labrenzia sp. PHM005
Pathway
labp00071  Fatty acid degradation
labp00072  Synthesis and degradation of ketone bodies
labp00280  Valine, leucine and isoleucine degradation
labp00310  Lysine degradation
labp00362  Benzoate degradation
labp00380  Tryptophan metabolism
labp00620  Pyruvate metabolism
labp00630  Glyoxylate and dicarboxylate metabolism
labp00640  Propanoate metabolism
labp00650  Butanoate metabolism
labp00900  Terpenoid backbone biosynthesis
labp01100  Metabolic pathways
labp01110  Biosynthesis of secondary metabolites
labp01120  Microbial metabolism in diverse environments
labp01200  Carbon metabolism
labp01212  Fatty acid metabolism
labp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:labp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FJ695_27330
   00630 Glyoxylate and dicarboxylate metabolism
    FJ695_27330
   00640 Propanoate metabolism
    FJ695_27330
   00650 Butanoate metabolism
    FJ695_27330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FJ695_27330
   00072 Synthesis and degradation of ketone bodies
    FJ695_27330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FJ695_27330
   00310 Lysine degradation
    FJ695_27330
   00380 Tryptophan metabolism
    FJ695_27330
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FJ695_27330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FJ695_27330
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FJ695_27330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:labp04147]
    FJ695_27330
Enzymes [BR:labp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FJ695_27330
Exosome [BR:labp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FJ695_27330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Porin_3
Motif
Other DBs
NCBI-ProteinID: QDG79275
UniProt: A0A4Y6S441
Position
complement(6032424..6033590)
Genome map
AA seq 388 aa AA seqDB search
MTAAMVGWAHLPFGKHTDETVESMIVNAASEAIKDAGISPEDVDEIVLGHFNAGFSQQDF
TAALVLQANPALRFTPATRVENACATGSAAVHQGVRAVSSGAARFVLVVGVEQMTTTPGP
EIGKNLLKASYLKEDGDTPAGFAGVFGKIADSYFQKYGDQSDALAKIAAKNHKNGVGNPY
AQMRKDLGYDFCRDESEKNPFVAGPLKRTDCSLVSDGAAAMILTDPATALGMKKAVAFRG
MAHVQDFLPMSKRDILKFEGCSKAWGAALGDASLAIEDLSFVETHDCFTIAELIEYEAMG
LTKEGEGAKAVLEGWTEMDGKLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLTGTAGDIQ
VKNAELGGIFNMGGAAVANYVSILQAMK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcgatggttggctgggcgcatctgcccttcggaaagcatacggacgagacg
gtcgagagtatgatcgtcaatgcggccagcgaagcgatcaaggacgctggtatctcccca
gaagatgttgatgaaattgttctgggccattttaacgccggtttctcccagcaagacttc
acggccgcactggtcctgcaggccaatccagcgctaaggtttacaccggcaacccgtgtt
gagaacgcatgtgccaccggttctgccgccgttcatcaaggcgttcgggcggtatcttcc
ggtgcagcgcggtttgtgcttgttgtcggtgtggagcagatgacaaccacaccaggcccg
gaaatcggaaagaacctgctgaaagcgtcatatctgaaagaagacggggatacgccggcc
ggttttgctggggtttttggcaagatcgccgattcatacttccaaaaatatggcgatcag
tctgatgctttggcgaagattgcagccaaaaaccacaagaacggcgtgggcaatccctat
gctcagatgcgcaaggatctcggctacgatttctgccgtgatgagagcgaaaaaaacccg
tttgttgctggtcccttgaagcggactgattgttccttggtctccgatggcgcagcagcc
atgattctaaccgacccggcaacggcacttggtatgaaaaaggccgttgctttccgtggt
atggctcatgtccaggacttcctgccgatgtccaagcgcgacatcctgaaattcgaaggc
tgttccaaagcctggggcgctgcgctcggagatgccagccttgcgattgaagacctgtca
ttcgtagaaacccacgactgtttcaccatcgccgaactgatcgaatacgaagcgatgggc
ctgaccaaagaaggtgagggcgcaaaagcggtgctggaaggctggacagaaatggacggc
aagctgccagtcaatccatctggtggcttgaaagccaaaggccatccgatcggtgcgacc
ggcgtttctatgcacgtgctgactgccatgcagctgaccggcacggcaggcgatattcag
gtgaaaaacgccgagctcggcgggatcttcaacatgggtggtgcggccgtcgcaaactat
gtttcgatccttcaggcaatgaagtag

DBGET integrated database retrieval system