KEGG   Labrenzia sp. VG12: CHH27_02595Help
Entry
CHH27_02595       CDS       T04984                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00670  One carbon pool by folate
labr01100  Metabolic pathways
labr01120  Microbial metabolism in diverse environments
labr01200  Carbon metabolism
Module
labr_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CHH27_02595
Enzymes [BR:labr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CHH27_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS ETF
Motif
Other DBs
NCBI-ProteinID: ASP32266
UniProt: A0A222F0Y7
Position
complement(557263..558933)
Genome map
AA seq 556 aa AA seqDB search
MASDIEIARAASMKPIQEIGERLNIPEESLLPYGRTKAKISGDYIESLNGRDSGKLILVT
AINPTPAGEGKTTTTVGLGDGLNKIGKNAMICLREPSLGPCFGMKGGAAGGGYAQVVPME
DINLHFTGDFHAITSAHNLLAALIENHIYWGNELGIDQRRVTWRRVLDMNDRALREIVCS
LGGVANGFPREGGFDITVASEIMAILCLATDLDDLQKRLGDIIVAYRRDRTAITARELEA
DGAMTVLLKEAMQPNLVQTLENNPAFIHGGPFANIAHGCNSVVATQTALKLADYVVTEAG
FGADLGAEKFFDIKCRKAGLSPDAVVIVATIKALKMNGGVAKEDLGAENVDAVVNGCANL
GRHIENVKQFGVPAVVAINHFTADTEAEVQAVRDYCAELGVDAILATHWANGSAGTEELA
KRVSELAESGAAQFAPLYDDSLSLFEKIETIAKRIYRADEVLADKSVRDQLKRWEADGFG
DLPVCMAKTQYSFSTDPQLRGAPTGHSLPVREVRLSAGAGFIVVICGEIMTMPGLPRVPS
ANHIKLDEQGQIEGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgatatcgaaattgcccgtgcagccagcatgaaaccgatccaggagatcggt
gagcggctcaacattcccgaggaatccctgctgccctatggccgcacgaaggcaaagatc
tccggggactacatcgaaagcctcaacgggcgcgacagcggcaagctcatcctggtcacc
gcgatcaacccgacgccggccggtgaaggcaagacgaccacgacggtcggcctcggcgac
ggtctcaacaagatcggcaagaacgccatgatctgcctgcgcgaaccgtctctcggcccc
tgcttcggcatgaagggtggcgcggccggtggcggctatgcccaggtcgttccgatggaa
gacatcaacctgcatttcaccggtgacttccacgccattacctccgcacataacctgctg
gccgctctgatcgagaaccacatctactggggcaatgagctgggcatcgaccagcgccgc
gtgacctggcgccgagtgctcgacatgaacgaccgcgccctgcgcgaaatcgtctgctcc
ctcggcggtgttgccaacggtttcccgcgtgaaggcggcttcgacatcacggtggcttcc
gaaatcatggcgatcctgtgcctcgcaacagatctggacgacctgcagaagcgtcttggc
gacatcatcgttgcctatcgccgcgaccgcaccgcgatcaccgcgcgcgagctggaagcc
gatggcgcgatgaccgttcttttgaaggaagccatgcagccgaacctggtgcagacgctg
gaaaacaacccggccttcatccacggcggccccttcgccaacatcgcccatggctgcaac
tccgtcgttgccacacagacggccctgaaactggcggactacgtggtgaccgaagccggc
tttggtgctgacctgggcgccgaaaagttcttcgacatcaagtgccgcaaggccggcctg
tcgccggacgccgtggtgatcgtcgccacgatcaaggccctgaagatgaatggcggtgtc
gccaaggaagacctcggcgcagaaaatgtcgacgcggtcgtgaatggctgcgccaacctc
ggccgccatatcgagaacgtcaagcagttcggcgtcccggccgttgtcgccatcaaccac
ttcaccgccgacaccgaagccgaagtgcaggccgtgagggactattgcgccgagctcggc
gtcgacgcgatcctggcaacccactgggccaacggctccgccggcacggaagagcttgcc
aagcgcgtgtccgaacttgctgaaagcggcgcggcacagttcgccccgctttatgacgac
agcctgtcgctgttcgaaaagatcgagaccatcgccaagcgcatctaccgcgccgacgag
gtgctcgccgacaagtccgtgcgcgaccagctcaagcgctgggaagccgacggtttcggc
gacctgccggtctgcatggccaagacccagtattccttctccaccgatccgcagctgcgc
ggagcgcccaccggccacagcctgccggtgcgcgaagtgcgcctgtcggccggcgccggc
ttcatcgtggtgatctgcggggaaatcatgaccatgcccggcctgccgcgcgtgccctcg
gccaaccacatcaagctggacgagcaaggtcagattgaagggctgttctga

DBGET integrated database retrieval system