KEGG   Labrenzia sp. VG12: CHH27_02860Help
Entry
CHH27_02860       CDS       T04984                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:labr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CHH27_02860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:labr01007]
    CHH27_02860
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:labr03016]
    CHH27_02860
Enzymes [BR:labr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     CHH27_02860
Amino acid related enzymes [BR:labr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CHH27_02860
Transfer RNA biogenesis [BR:labr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CHH27_02860
 Prokaryotic Type
    CHH27_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f DUF550
Motif
Other DBs
NCBI-ProteinID: ASP32310
UniProt: A0A222F0K1
Position
618733..620148
Genome map
AA seq 471 aa AA seqDB search
MSAAETEKSGTFKGLKLTNTLTRAKEEFRAIDDENVRLYVCGPTVYDYAHIGNARPAIVF
DVLFRLLRQLYGADHVTYARNITDVDDKINARALRDHPALPLNEAIALVTKKTADQYHKD
IKALAVQEPTFEPRATQHIDGMVEMIATLIDKGHAYEAGGEVLFDTASMPDYGGLSKRKL
DEQLAGARIAVDEHKKNPGDFVLWKLSSAEEPGWESPWGRGRPGWHIECSVMSAHHLGKV
FDIHGGGLDLIFPHHENEIAQSCCANDTSTMANYWMHNGFLQVEGRKMSKSEGNFFTIQE
LLETESFGGRKWPGEVLRMAMLMTNYREPIDFSQRKLEEAENLLARWPDPVPTDAAPAPE
VLEPMLDDLNTSAAIQALHALAVEAAKDPSRLEDYSASAALLGLGPVQADLSGIDEAAIQ
AAIGRRLEALKAKNWSEADEIRNELTSQGILLKDSKDSATGERVTTWEVKR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctgagacagaaaaatccggcactttcaagggcttgaagctcaccaataca
ttgacgcgcgccaaggaggaattccgcgcgatcgatgacgagaacgtgcgtctctatgtc
tgcggaccgacggtttacgactacgcccatatcggcaatgcccggccggccatcgtcttc
gatgtgctgttccgcctgcttcgccagctctatggtgcggatcatgtcacctatgcgcgc
aacatcaccgacgtcgatgacaagatcaacgcgcgggctttgcgcgatcatccggccctg
ccgctgaacgaggccatcgcgctggtcaccaagaagacggccgatcagtaccacaaggac
atcaaggctcttgcggtgcaagaaccgacattcgagccacgggcgacccagcatatcgac
ggcatggtggagatgatcgcaacgctgatcgacaagggccacgcctatgaagcgggcggc
gaggtgctgttcgacacggcctccatgccggactatggcggactgtccaagcgcaagctc
gatgagcagctggccggcgcccgtatcgccgtcgatgaacacaagaaaaaccctggcgat
ttcgtgctctggaaactctcctcagccgaagagccgggctgggagagcccctgggggcgt
ggacgccctggctggcatatcgagtgctcggtcatgagcgctcatcatctcggcaaggtg
ttcgacattcacggtggcggtctggatctgatcttccctcaccatgaaaacgagatcgcc
cagtcgtgctgcgcaaacgacacgtccaccatggccaattactggatgcacaacggcttc
ctgcaggtggaaggccggaagatgtccaagtccgagggcaatttcttcaccattcaggag
cttctggaaacggagagtttcggtgggcgcaaatggccgggcgaagtccttcgcatggcc
atgctgatgaccaattaccgcgagccgatcgacttctcccagcgcaagctggaggaggcg
gagaacctgcttgcgcgctggccggatccggtgccaaccgatgcagcccctgcaccggaa
gttctggagccgatgctggatgacctgaacacgtctgcggccattcaggccctgcacgcg
cttgcggtcgaggcggccaaggacccgtccagactggaggactattccgcctccgccgca
ctgctggggttgggaccggttcaggcggacctcagcggcatcgatgaagccgccatccag
gccgccatcggccgccggctggaggcgctcaaggccaagaactggtctgaggccgacgag
atccgcaatgaactgacctctcagggaatcctgctaaaggattcaaaagactcggcaacc
ggcgagcgcgtgaccacctgggaggtcaagcggtga

DBGET integrated database retrieval system